Protein Info for DVU1944 in Desulfovibrio vulgaris Hildenborough JW710
Name: oorD
Annotation: pyruvate ferredoxin oxidoreductase, iron-sulfur binding subunit, putative (TIGR)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
KEGG orthology group: K00176, 2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC: 1.2.7.3] (inferred from 100% identity to dvu:DVU1944)Predicted SEED Role
"2-oxoglutarate oxidoreductase, delta subunit, putative (EC 1.2.7.3)" (EC 1.2.7.3)
MetaCyc Pathways
- reductive TCA cycle I (9/11 steps found)
- incomplete reductive TCA cycle (6/7 steps found)
- TCA cycle V (2-oxoglutarate synthase) (7/9 steps found)
- TCA cycle VI (Helicobacter) (7/9 steps found)
- TCA cycle VII (acetate-producers) (6/9 steps found)
- reductive TCA cycle II (7/12 steps found)
- Methanobacterium thermoautotrophicum biosynthetic metabolism (22/56 steps found)
KEGG Metabolic Maps
Isozymes
Compare fitness of predicted isozymes for: 1.2.7.3
Use Curated BLAST to search for 1.2.7.3
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q72AP8 at UniProt or InterPro
Protein Sequence (90 amino acids)
>DVU1944 pyruvate ferredoxin oxidoreductase, iron-sulfur binding subunit, putative (TIGR) (Desulfovibrio vulgaris Hildenborough JW710) MAKISKGQTLVCVYPDWCKGCGLCVAFCPGKVLELNPLGKAEVAHPEECINCGFCELHCP DFAIAIKPKASGQSCPSHGKAEPNPNSDEY