Protein Info for DVU1944 in Desulfovibrio vulgaris Hildenborough JW710

Name: oorD
Annotation: pyruvate ferredoxin oxidoreductase, iron-sulfur binding subunit, putative (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 90 PF00037: Fer4" amino acids 13 to 33 (21 residues), 21.6 bits, see alignment 4.5e-08 amino acids 45 to 64 (20 residues), 23.6 bits, see alignment 1.1e-08 PF13237: Fer4_10" amino acids 15 to 60 (46 residues), 31.2 bits, see alignment E=5.4e-11 PF12800: Fer4_4" amino acids 15 to 29 (15 residues), 21.2 bits, see alignment 8.1e-08 amino acids 46 to 60 (15 residues), 15.1 bits, see alignment 7.3e-06 PF13187: Fer4_9" amino acids 18 to 62 (45 residues), 32.5 bits, see alignment E=2.2e-11 PF12838: Fer4_7" amino acids 18 to 60 (43 residues), 37 bits, see alignment E=1.2e-12

Best Hits

KEGG orthology group: K00176, 2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC: 1.2.7.3] (inferred from 100% identity to dvu:DVU1944)

Predicted SEED Role

"2-oxoglutarate oxidoreductase, delta subunit, putative (EC 1.2.7.3)" (EC 1.2.7.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.7.3

Use Curated BLAST to search for 1.2.7.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72AP8 at UniProt or InterPro

Protein Sequence (90 amino acids)

>DVU1944 pyruvate ferredoxin oxidoreductase, iron-sulfur binding subunit, putative (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MAKISKGQTLVCVYPDWCKGCGLCVAFCPGKVLELNPLGKAEVAHPEECINCGFCELHCP
DFAIAIKPKASGQSCPSHGKAEPNPNSDEY