Protein Info for DVU1942 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: DAK2 domain/degV family protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 637 PF02734: Dak2" amino acids 43 to 208 (166 residues), 132.3 bits, see alignment E=3.6e-42 PF21645: FakA-like_M" amino acids 242 to 317 (76 residues), 83.7 bits, see alignment E=1.3e-27 PF02645: DegV" amino acids 326 to 602 (277 residues), 219 bits, see alignment E=1.7e-68 TIGR00762: EDD domain protein, DegV family" amino acids 327 to 601 (275 residues), 264.1 bits, see alignment E=6.3e-83 PF13684: FakA-like_C" amino acids 381 to 603 (223 residues), 55 bits, see alignment E=1.5e-18

Best Hits

KEGG orthology group: K07030, (no description) (inferred from 100% identity to dvu:DVU1942)

Predicted SEED Role

"Dihydroxyacetone kinase family protein" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72AQ0 at UniProt or InterPro

Protein Sequence (637 amino acids)

>DVU1942 DAK2 domain/degV family protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MPLSQTPARIRYLDGIRFKRVVQAAATRLIERHDHLNAINVFPVPDGDTGSNMAGTMRSI
VSSTGDAIEQSIGRMSKVVAESALMGARGNSGVILAQFLCGFSEGVKGLSRISPQDFAKA
ASLAATRARESIANPKEGTILSVIHDWAAHLHDNRHSYDDFHQLLRDSIERARTSLAETR
EKLASLRAADVVDAGGQGFVYLLEGILEFTERGTITARKEGDDAEDTEAGLAQERVSVEE
LTYGYCTECLLSGDDIDRETLRVRLEPMGDSLVVAGTASLVRVHIHTDEPDTVFGIAAEY
GEVRHRKVEDMLRQHRDLLGLTTQPVGIVTDSTCDLPRDLLDEYGIATVPLRLFLDDEEY
ADKVDITAEEFNRRLPTSRSARTSQPAPADFATAYRGQLARHRDIVSLHVMAMYSGTCQS
ATAVGRTFDGHVHVLDTRTLSCGLGLVVLEAARRAREGMAADEILRLAQQDADNLRVFVS
MDTLDFAVRGGRMSRGTGMVAKLLNIKPVVEFAVRNEGKVDVVAKAIGVRRSEARLIDLL
RRDAEGMTNLRFAIAHVGAPQTALRYAEVLKTTFGVAPDYIMPASAVLGTHSGPGACAVA
MLGDRPSTEDANTTTGGATDITPDATESPSAQHSATA