Protein Info for DVU1940 in Desulfovibrio vulgaris Hildenborough JW710

Name: glpA
Annotation: anaerobic glycerol-3-phosphate dehydrogenase, A subunit, putative (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01494: FAD_binding_3
  • amino acids 2 to 207 (206 residues), 29 bits, E=9.8e-11
• TIGR03377: glycerol-3-phosphate dehydrogenase, anaerobic, A subunit
  • amino acids 4 to 514 (511 residues), 570.7 bits, E=1.4e-175
• PF01266: DAO
  • amino acids 5 to 350 (346 residues), 149.9 bits, E=2.2e-47
• PF00890: FAD_binding_2
  • amino acids 5 to 208 (204 residues), 21.4 bits, E=1.9e-08

Best Hits

KEGG orthology group: K00111, glycerol-3-phosphate dehydrogenase [EC: 1.1.5.3] (inferred from 100% identity to dvl:Dvul_1228)

Predicted SEED Role

"Anaerobic glycerol-3-phosphate dehydrogenase subunit A (EC 1.1.5.3)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization or Glycerolipid and Glycerophospholipid Metabolism in Bacteria or Respiratory dehydrogenases 1 (EC 1.1.5.3)

MetaCyc Pathways

• glycerol-3-phosphate shuttle (2/2 steps found)
• glycerol-3-phosphate to fumarate electron transfer (2/2 steps found)
• glycerophosphodiester degradation (2/2 steps found)
• glycerol and glycerophosphodiester degradation (3/4 steps found)
• glycerol degradation I (2/3 steps found)
• glycerol 3-phosphate to cytochrome aa₃ oxidase electron transfer (1/2 steps found)
• glycerol-3-phosphate to cytochrome bo oxidase electron transfer (1/2 steps found)
• glycerol-3-phosphate to hydrogen peroxide electron transport (1/2 steps found)
• nitrate reduction IX (dissimilatory) (1/2 steps found)
• sn-glycerol 3-phosphate anaerobic respiration (1/3 steps found)

KEGG Metabolic Maps

• Glycerophospholipid metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.1.5.3

Use Curated BLAST to search for 1.1.5.3

Sequence Analysis Tools

See Q72AQ2 at UniProt or InterPro

Protein Sequence (516 amino acids)

>DVU1940 anaerobic glycerol-3-phosphate dehydrogenase, A subunit, putative (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MQTQVLIIGAGATGTGVARDLALRGVDCILIDQRDVNAGASGGNHGLLHSGGRYVFTDPH
AAAECKAEGDILKRIAPQCIEETGGYFVAVEGDDPAYASDFPGYCAKAGVPCREVDAHEA
RRNEPAIAESTFAVYEVEDASVDPFKLSLENVADAGRHGGRYLRYTRVLGFDMERGRIVA
ARVEDMRSGREYRIVADEYVVAAGAWSGGITAMAGCHVDIVYAKGTLLVTQTRMAHRVIN
RLRTPGDGDILVPGGTVSVLGTTSLRVESPDDVRPTVAEVDVNINEGMGMVPSLADARFI
RAYAGVRPLVRSGKPSGSDRAASRGFVLLDHEEDGVHNLVTIAGGKLTTYRLMAERAADL
VCERLGVSAPCLTAVRPISPSDEAEWAEPGVLQKQNWWRNHDRDDYLLCECEIVPKSGVD
SIIATFKDEAEPPRLLAIGLRSRVGKGSCQGAFCGARITAHMHDRRIIEGREGLDGLREF
LGARWKGQRPILWGAQFNQAELKEALYFGLVGMELE