Protein Info for DVU1935 in Desulfovibrio vulgaris Hildenborough JW710

Name: phnE
Annotation: phosphonate ABC transporter, permease protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 265 transmembrane" amino acids 20 to 39 (20 residues), see Phobius details amino acids 75 to 101 (27 residues), see Phobius details amino acids 113 to 133 (21 residues), see Phobius details amino acids 139 to 160 (22 residues), see Phobius details amino acids 175 to 199 (25 residues), see Phobius details amino acids 211 to 230 (20 residues), see Phobius details amino acids 236 to 257 (22 residues), see Phobius details TIGR01097: phosphonate ABC transporter, permease protein PhnE" amino acids 20 to 262 (243 residues), 262.3 bits, see alignment E=2.2e-82 PF00528: BPD_transp_1" amino acids 94 to 258 (165 residues), 64.4 bits, see alignment E=5.7e-22

Best Hits

Swiss-Prot: 40% identical to PHNE_ECOBD: Phosphonate transport system permease protein PhnE (phnE) from Escherichia coli (strain B / BL21-DE3)

KEGG orthology group: K02042, phosphonate transport system permease protein (inferred from 100% identity to dvl:Dvul_1232)

Predicted SEED Role

"Phosphonate ABC transporter permease protein phnE2 (TC 3.A.1.9.1)" in subsystem ABC transporter alkylphosphonate (TC 3.A.1.9.1) (TC 3.A.1.9.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72AQ7 at UniProt or InterPro

Protein Sequence (265 amino acids)

>DVU1935 phosphonate ABC transporter, permease protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MAAMSASAIKRPSPFEVNWWARAGYLLVALYCVYAVNALDISFDRIIIGLDNGAKFLGSM
FPPVFKRWALLIDNLIETVQIAIISSAFGVAISLPVGLCAARNLMPDWLTWPSRAFIAVC
RSFHPVIFAILFVKAVGFGPLAGILTLIFASIGFVAKLFAEAIEEISLKPVEAMRAAGAP
FMSVLVYSVLPQVLNRFIGFATYQTDANLRNSTMIGIVGAGGIGGTLAAAFQRFDYGFVC
AILISIIALIMVSELLAQRVKGVFR