Protein Info for DVU1933 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: peptidase, PfpI family (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 173 PF01965: DJ-1_PfpI" amino acids 7 to 170 (164 residues), 159.6 bits, see alignment E=3.1e-51 TIGR01382: intracellular protease, PfpI family" amino acids 9 to 170 (162 residues), 158.8 bits, see alignment E=4.7e-51

Best Hits

Swiss-Prot: 50% identical to DEGLY_PYRAB: Deglycase PYRAB04690 (PYRAB04690) from Pyrococcus abyssi (strain GE5 / Orsay)

KEGG orthology group: K05520, protease I [EC: 3.2.-.-] (inferred from 100% identity to dvu:DVU1933)

MetaCyc: 48% identical to archaeal arginyl aminopeptidase monomer (Pyrococcus horikoshii OT3)
RXN-23973 [EC: 3.4.11.27]

Predicted SEED Role

"ThiJ/PfpI family protein"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.2.-.-

Use Curated BLAST to search for 3.2.-.- or 3.4.11.27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72AQ9 at UniProt or InterPro

Protein Sequence (173 amino acids)

>DVU1933 peptidase, PfpI family (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MQRLAGKRVLMFVDDIYEDLELWYPRLRLEEEGATVVVAGPEKGRSYAGKHSYPCVADAA
IADMNAADFDLLVIPGGFAPDKLRRDPKVLELTRQMHHAGKIVAHICHAGWIPISAGIMR
GYRCTSTPGIKDDLINAGALWENSEVVVDRNQISSRKPGDLPAFCRAIIEHAV