Protein Info for DVU1932 in Desulfovibrio vulgaris Hildenborough JW710

Name: adk
Annotation: adenylate kinase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00406: ADK
  • amino acids 5 to 182 (178 residues), 128.2 bits, E=3e-41
• PF13207: AAA_17
  • amino acids 6 to 127 (122 residues), 65.4 bits, E=7e-22

Best Hits

Swiss-Prot: 100% identical to KAD_DESVH: Adenylate kinase (adk) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: K00939, adenylate kinase [EC: 2.7.4.3] (inferred from 100% identity to dvl:Dvul_1235)

Predicted SEED Role

"Adenylate kinase (EC 2.7.4.3)" in subsystem Purine conversions (EC 2.7.4.3)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (42/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (23/26 steps found)
• superpathway of purine nucleotide salvage (13/14 steps found)
• superpathway of adenosine nucleotides de novo biosynthesis I (5/5 steps found)
• superpathway of adenosine nucleotides de novo biosynthesis II (6/7 steps found)
• adenosine ribonucleotides de novo biosynthesis (3/3 steps found)
• purine deoxyribonucleosides salvage (4/6 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.4.3

Sequence Analysis Tools

See Q72AR0 at UniProt or InterPro

Protein Sequence (223 amino acids)

>DVU1932 adenylate kinase (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MNILIFGPNGSGKGTQGALVKKKYDLAHIESGAIFREHIGGGTELGKQAKAFIERGDLVP
DDITIPMVLETLKSKGANGWLLDGFPRNMVQAQKLWDALQAEGMKLDYVIEILLPREVAK
NRIMGRRLCKNDNNHPNNIFIDAIKPNGDVCRVCGGELSARSDDQDEGAIGKRHDIYYNT
VDGTLAAAYFYKDLAAKGMTKYIELDGEGAIDAIKDKLLAQLS