Protein Info for DVU1928 in Desulfovibrio vulgaris Hildenborough JW710

Name: lspA
Annotation: lipoprotein signal peptidase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 165 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details transmembrane" amino acids 66 to 86 (21 residues), see Phobius details amino acids 93 to 111 (19 residues), see Phobius details amino acids 131 to 154 (24 residues), see Phobius details TIGR00077: signal peptidase II" amino acids 6 to 155 (150 residues), 122.1 bits, see alignment E=1e-39 PF01252: Peptidase_A8" amino acids 12 to 153 (142 residues), 144.1 bits, see alignment E=1.8e-46

Best Hits

Swiss-Prot: 100% identical to LSPA_DESVH: Lipoprotein signal peptidase (lspA) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: K03101, signal peptidase II [EC: 3.4.23.36] (inferred from 100% identity to dvl:Dvul_1239)

Predicted SEED Role

"Lipoprotein signal peptidase (EC 3.4.23.36)" in subsystem Sex pheromones in Enterococcus faecalis and other Firmicutes or Signal peptidase (EC 3.4.23.36)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.23.36

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72AR4 at UniProt or InterPro

Protein Sequence (165 amino acids)

>DVU1928 lipoprotein signal peptidase (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MLSLKYRIVLGLAAVVMLIDQGTKWLVEATIPFHGTVPVIHGVFDLVNIRNRGAAFGFLN
RSDIEWQFWLFLVATVLAVWAILSLTRASKNEPVLYTAFGLIMGGALGNLVDRIRYRAVV
DFLDFYWGEWHWPAFNVADIAICIGAFLAFVAMYRQPSPERGNKE