Protein Info for DVU1909 in Desulfovibrio vulgaris Hildenborough JW710

Name: acpS
Annotation: holo-(acyl-carrier-protein) synthase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 124 TIGR00516: holo-[acyl-carrier-protein] synthase" amino acids 1 to 124 (124 residues), 110.6 bits, see alignment E=6e-36 TIGR00556: phosphopantetheine--protein transferase domain" amino acids 1 to 124 (124 residues), 95.9 bits, see alignment E=2e-31 PF01648: ACPS" amino acids 4 to 98 (95 residues), 62.2 bits, see alignment E=2.2e-21

Best Hits

Swiss-Prot: 100% identical to ACPS_DESVH: Holo-[acyl-carrier-protein] synthase (acpS) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: K00997, holo-[acyl-carrier protein] synthase [EC: 2.7.8.7] (inferred from 99% identity to dvl:Dvul_1255)

Predicted SEED Role

"Holo-[acyl-carrier protein] synthase (EC 2.7.8.7)" in subsystem Fatty Acid Biosynthesis FASII (EC 2.7.8.7)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.8.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72AT2 at UniProt or InterPro

Protein Sequence (124 amino acids)

>DVU1909 holo-(acyl-carrier-protein) synthase (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MIVGIGIDITEIDRIAKGWGRFGDRFARRILHPHEVVRMPAANPVAFLAGRFAVKEAAVK
ALGTGFSGGIGPRDIEVGVAPAGAPQLVLHGKAAARMEALGATRTHVSLTHGRDTAAAVV
ILES