Protein Info for DVU1890 in Desulfovibrio vulgaris Hildenborough JW710

Name: hemC
Annotation: porphobilinogen deaminase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00212: hydroxymethylbilane synthase
  • amino acids 4 to 297 (294 residues), 356.1 bits, E=6.1e-111
• PF01379: Porphobil_deam
  • amino acids 4 to 212 (209 residues), 280.1 bits, E=1e-87
• PF03900: Porphobil_deamC
  • amino acids 226 to 295 (70 residues), 58.6 bits, E=6.7e-20

Best Hits

Swiss-Prot: 100% identical to HEM3_DESVH: Porphobilinogen deaminase (hemC) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: K01749, hydroxymethylbilane synthase [EC: 2.5.1.61] (inferred from 99% identity to dvl:Dvul_1273)

Predicted SEED Role

"Porphobilinogen deaminase (EC 2.5.1.61)" in subsystem Experimental tye or Heme and Siroheme Biosynthesis (EC 2.5.1.61)

MetaCyc Pathways

• adenosylcobalamin biosynthesis II (aerobic) (27/33 steps found)
• adenosylcobalamin biosynthesis I (anaerobic) (29/36 steps found)
• tetrapyrrole biosynthesis I (from glutamate) (6/6 steps found)
• dipyrromethane cofactor biosynthesis (3/4 steps found)
• tetrapyrrole biosynthesis II (from glycine) (3/4 steps found)
• superpathway of heme b biosynthesis from glutamate (6/10 steps found)
• superpathway of heme b biosynthesis from glycine (3/8 steps found)
• superpathway of bacteriochlorophyll a biosynthesis (3/26 steps found)

KEGG Metabolic Maps

• Porphyrin and chlorophyll metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.61

Sequence Analysis Tools

See Q72AV0 at UniProt or InterPro

Protein Sequence (315 amino acids)

>DVU1890 porphobilinogen deaminase (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MKHLVIATRGSKLALWQAEHIKSLIETEHAGKVDVSLKIIKTKGDIILDVPLAKVGGKGL
FVKEIEEALLDGSADLAVHSMKDVPMELPEGLFLGCIPEREEPSDTLLSVRYASLDALPH
GARVGTSSLRRQSQLLALRPDLDIISLRGNVDTRLRKLMDGEFDAIVMATAGLKRLGLAA
PHHEVLAPPRFLPAVGQGALGIEFREDRADLRDMLAFLDHRPTRIRVEAERGFLAGLEGG
CQVPIAGHAVMTGDDNFRIEGLVADLKGERVIRRTLEGTGANARNRGLELASQVLADGAA
EILDEVYASGAADRQ