Protein Info for DVU1890 in Desulfovibrio vulgaris Hildenborough JW710

Name: hemC
Annotation: porphobilinogen deaminase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 315 TIGR00212: hydroxymethylbilane synthase" amino acids 4 to 297 (294 residues), 356.1 bits, see alignment E=6.1e-111 PF01379: Porphobil_deam" amino acids 4 to 212 (209 residues), 280.1 bits, see alignment E=1e-87 PF03900: Porphobil_deamC" amino acids 226 to 295 (70 residues), 58.6 bits, see alignment E=6.7e-20

Best Hits

Swiss-Prot: 100% identical to HEM3_DESVH: Porphobilinogen deaminase (hemC) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: K01749, hydroxymethylbilane synthase [EC: 2.5.1.61] (inferred from 99% identity to dvl:Dvul_1273)

Predicted SEED Role

"Porphobilinogen deaminase (EC 2.5.1.61)" in subsystem Experimental tye or Heme and Siroheme Biosynthesis (EC 2.5.1.61)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.61

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72AV0 at UniProt or InterPro

Protein Sequence (315 amino acids)

>DVU1890 porphobilinogen deaminase (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MKHLVIATRGSKLALWQAEHIKSLIETEHAGKVDVSLKIIKTKGDIILDVPLAKVGGKGL
FVKEIEEALLDGSADLAVHSMKDVPMELPEGLFLGCIPEREEPSDTLLSVRYASLDALPH
GARVGTSSLRRQSQLLALRPDLDIISLRGNVDTRLRKLMDGEFDAIVMATAGLKRLGLAA
PHHEVLAPPRFLPAVGQGALGIEFREDRADLRDMLAFLDHRPTRIRVEAERGFLAGLEGG
CQVPIAGHAVMTGDDNFRIEGLVADLKGERVIRRTLEGTGANARNRGLELASQVLADGAA
EILDEVYASGAADRQ