Protein Info for DVU1882 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: HDIG domain protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 786 transmembrane" amino acids 254 to 278 (25 residues), see Phobius details amino acids 290 to 310 (21 residues), see Phobius details amino acids 322 to 342 (21 residues), see Phobius details amino acids 349 to 376 (28 residues), see Phobius details amino acids 391 to 411 (21 residues), see Phobius details amino acids 423 to 444 (22 residues), see Phobius details PF07697: 7TMR-HDED" amino acids 10 to 249 (240 residues), 132.4 bits, see alignment E=3.8e-42 PF07698: 7TM-7TMR_HD" amino acids 264 to 452 (189 residues), 66.4 bits, see alignment E=5.2e-22 TIGR00277: HDIG domain" amino acids 475 to 572 (98 residues), 77.4 bits, see alignment E=3e-26 PF01966: HD" amino acids 477 to 618 (142 residues), 63.1 bits, see alignment E=4.5e-21

Best Hits

KEGG orthology group: K07037, (no description) (inferred from 100% identity to dvl:Dvul_1282)

Predicted SEED Role

"Membrane protein containing HD superfamily hydrolase domain, YQFF ortholog"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72AV8 at UniProt or InterPro

Protein Sequence (786 amino acids)

>DVU1882 HDIG domain protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MKAPARVLVAGEIAPHDIVADRDLLVEDQQATRARREQAGMLQPAVFELSTEPLLHLRER
VHEVFQSLNNAEIGDLEPLRLALSDQLGTDISMRTLTVWSSESFQSYVTTNVLPWTEARL
SDGVSSDMRILLQFKGGILVRDLTTGTETLRTNLHAIPDIRTVTSELTQTLKNDGQLQLA
TRRAILSLIEPLLVPTLTLNREATAARSAEVTDAIEPVLYRLQRGEVIVRQGERVGREQQ
LKIQSLYSVRSKRLHSLTVVGTAVSAAILAFGLFFAPSGRPGRPLQRKDLLFISLLLLGF
ALAAKGLNQLAPGITDGIATERLAYCFPVAGAAGLSALIFSARRYCVTGLLLAFFCTVLL
QGGLPLFLFFFVGAMLNTWLVTRAQTRQDVVWSFFPLLGGLLVCGLASALLEGLRGTPLV
HTLLLVGANAMISMLLLFALSPFLEMAFRYTTRFRLMELMSLEQPLLQDLMVTVPGTYHH
SLIVANMVEAGAKNIGANSLLCKVAALYHDIGKLSKPEYFIENQFGSRNKHDKLAPSMSA
LIITSHVKKGVELAEKHRLGQEIVDILRQHHGTRVIRYFFQKAVDLGEKPREEDYSYPGP
RPQSREAAIVMLADAVEASSRTLVDPTPARIKGHIDTIVKGIFAEGQLDESELTFKDLHK
LSQSFHRILTGIFHQRIEYPDANKDKKPRNEQNDKAPAVQEQPSQSDSAETASVQTTELS
RQTGGKNGNGKGNATISGQPRTEGKTDSGNPAPDTEVDNDVESAAAGSENALPAATARRG
ERDGTA