Protein Info for DVU1881 in Desulfovibrio vulgaris Hildenborough JW710

Name: phoH
Annotation: phoH family protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 338 PF02562: PhoH" amino acids 119 to 328 (210 residues), 315.1 bits, see alignment E=2.8e-98 PF13604: AAA_30" amino acids 125 to 276 (152 residues), 27.5 bits, see alignment E=3.8e-10 PF13245: AAA_19" amino acids 126 to 275 (150 residues), 32.1 bits, see alignment E=1.8e-11

Best Hits

KEGG orthology group: K06217, phosphate starvation-inducible protein PhoH and related proteins (inferred from 100% identity to dvu:DVU1881)

Predicted SEED Role

"Phosphate starvation-inducible protein PhoH, predicted ATPase" in subsystem Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72AV9 at UniProt or InterPro

Protein Sequence (338 amino acids)

>DVU1881 phoH family protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MPKQGMTQTQTVETLSFDDAGLANQLFGAQNGNLDIIAERSGTSIDTCGNAVTVSGENAI
AVETVLRLLTQLYGLLKAGHPLYARDVTHAYSMLEREPATELRKVFREAVFVVSPRKTVT
AKTLSQRDYVDALRDNDMVFAVGPAGTGKTYLAVATALALLQARRVKRIILTRPAVEAGE
KLGFLPGDLVEKVNPYLRPLYDALHDMLDFQKVTDMLETGVIEIAPLAFMRGRTLNDAFI
ILDEAQNTTPEQMKMFLTRLGFGSRAVITGDVTQIDLPTSGRGDALSRSGLVQAMRILDG
VKGIRIIRFHEADVIRHPLVGRIVQAYERHESVKNNHT