Protein Info for DVU1863 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: flagellar synthesis regulator FleN, putative (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 272 transmembrane" amino acids 120 to 138 (19 residues), see Phobius details PF13614: AAA_31" amino acids 9 to 153 (145 residues), 45.3 bits, see alignment E=2.5e-15 PF10609: ParA" amino acids 9 to 246 (238 residues), 42.7 bits, see alignment E=1.1e-14 PF01656: CbiA" amino acids 10 to 227 (218 residues), 51.1 bits, see alignment E=3.3e-17 PF06564: CBP_BcsQ" amino acids 15 to 245 (231 residues), 34.3 bits, see alignment E=4.5e-12

Best Hits

KEGG orthology group: K04562, flagellar biosynthesis protein FlhG (inferred from 100% identity to dvu:DVU1863)

Predicted SEED Role

"Flagellar synthesis regulator FleN" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72AX7 at UniProt or InterPro

Protein Sequence (272 amino acids)

>DVU1863 flagellar synthesis regulator FleN, putative (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MTTNHTLSVSILSGKGGVGKTNIALNLGYCLHRGGHPLLLMDCDLGLANLDVLLGLAPER
TLHDLLLGGASIDDVAVPIEQGGFDFIPAASGGPELVELDSDMRSLLLQRLSPAFARYDY
LFLDLGAGLSPTVLAFAAMTRVRLVIITPEPTSLTDSYALMKVLATQHGVRDFHVIVNQA
EDRAEEQTAYRRLAAACDKFLGFTPEFLGGIRLDKALPEAVRRQKPLMQTNPRALAAQDI
FAIAVKLQRLRTALLPQLAEEPVLRALPADDY