Protein Info for DVU1840 in Desulfovibrio vulgaris Hildenborough JW710

Name: gcp
Annotation: metalloendopeptidase, putative, glycoprotease family (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 361 TIGR03723: tRNA threonylcarbamoyl adenosine modification protein TsaD" amino acids 4 to 327 (324 residues), 359.9 bits, see alignment E=1.1e-111 TIGR00329: metallohydrolase, glycoprotease/Kae1 family" amino acids 5 to 323 (319 residues), 303.4 bits, see alignment E=1.8e-94 PF00814: TsaD" amino acids 24 to 324 (301 residues), 282.9 bits, see alignment E=1.6e-88

Best Hits

Swiss-Prot: 100% identical to TSAD_DESVH: tRNA N6-adenosine threonylcarbamoyltransferase (tsaD) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: K01409, O-sialoglycoprotein endopeptidase [EC: 3.4.24.57] (inferred from 100% identity to dvl:Dvul_1322)

Predicted SEED Role

"TsaD/Kae1/Qri7 protein, required for threonylcarbamoyladenosine t(6)A37 formation in tRNA"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.24.57

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72B00 at UniProt or InterPro

Protein Sequence (361 amino acids)

>DVU1840 metalloendopeptidase, putative, glycoprotease family (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MLCIGIETSCDETGLALVRDGRLVHAVMSSQADIHALFGGVVPEIASREHYRLIGPLYDL
LLREAGVGPTELDAVAVARGPGLLGSLLVGMAFAKGLALGFDIPLVGVNHLHAHLLAAGL
ERELVFPALGLLVSGGHTHIYRIESPVSFRLLGRTLDDAAGEAYDKVAKMLRLPYPGGRI
LDQQGRRGIADPRLFPRPYTDNDNLDFSFSGLKTAVQTHLSRHPELVPSPDAAQAVAGGH
DAPEGLRNMCASFNEAVAETLCIKLGRALDGDDGVGVRALIVAGGVAANSYVREHTARLA
VSRGLELIVPSPPLCTDNGSMIAYAGWLLRQGGLSHSLDLEAVPRGRAIPDDYRQGPAGC
S