Protein Info for DVU1828 in Desulfovibrio vulgaris Hildenborough JW710

Name: gidA
Annotation: glucose inhibited division protein A (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 629 TIGR00136: tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA" amino acids 13 to 625 (613 residues), 807.7 bits, see alignment E=3.2e-247 PF01134: GIDA" amino acids 14 to 402 (389 residues), 538.1 bits, see alignment E=2e-165 PF21680: GIDA_C_1st" amino acids 465 to 560 (96 residues), 66.8 bits, see alignment E=3.7e-22 PF13932: SAM_GIDA_C" amino acids 563 to 625 (63 residues), 63.7 bits, see alignment E=2e-21

Best Hits

Swiss-Prot: 100% identical to MNMG_DESVH: tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG (mnmG) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: K03495, glucose inhibited division protein A (inferred from 100% identity to dvu:DVU1828)

Predicted SEED Role

"tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72B11 at UniProt or InterPro

Protein Sequence (629 amino acids)

>DVU1828 glucose inhibited division protein A (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MSTIRKPSPPDMYDCIVVGAGHAGCEAAMALARMGHATLLLTGNADRIGHLSCNPAIGGL
AKGHMVKEIDALGGMMGLWADEAGIQFRTLNSSKGPAVRATRAQIDRDAYLRVVRRDIFA
QPNLRVWQDMAESIIVEEGRAAGVRTAYGQEFRAHHVLLTTGTFLQGRIHVGLSNFPGGR
LGDAPATGLSASLRAIGLELGRLKTGTTPRLLRDSIDFSMMEVQPPDDPPRPFSFRGPGV
RLPQLPCHVTWTNERTHEAIRAGFDRSPMFTGVIKGTGARYCPSIEDKVARFPEKERHQV
FVEPEGLESPECYPNGIPTSLPLEVQKAMIATIPGLENAQIVRPGYAIEYDYADPVQLRS
TLETKALRGLWLAGQINGTSGYEEAAAQGLWAALNVSCTLRSMPPFLPGRDTAYMAVLVD
DLVTKGTREPYRMFTSRAEHRLLLRENNADARLTETGRALGLVDDTHWQLFSTKRAALHS
LLDELENRRITPDAAARDIFSRLGEPAPTKGVSLADILRRPSLTLPDLAPFWEGVTRFAD
DVREEAETIVKYSGYLARQQELVARSARMEDTVLPEDMDYTVIPGLTREIVEKLGKVRPH
TLGQAARISGVTPAALTCLEIQLRKMGQR