Protein Info for DVU1807 in Desulfovibrio vulgaris Hildenborough JW710

Name: nadC
Annotation: nicotinate-nucleotide pyrophosphorylase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 295 TIGR00078: nicotinate-nucleotide diphosphorylase (carboxylating)" amino acids 25 to 290 (266 residues), 279.6 bits, see alignment E=1.1e-87 PF02749: QRPTase_N" amino acids 31 to 119 (89 residues), 73.2 bits, see alignment E=1.5e-24 PF01729: QRPTase_C" amino acids 121 to 289 (169 residues), 179.5 bits, see alignment E=4.7e-57

Best Hits

KEGG orthology group: K00767, nicotinate-nucleotide pyrophosphorylase (carboxylating) [EC: 2.4.2.19] (inferred from 100% identity to dvl:Dvul_1353)

Predicted SEED Role

"Quinolinate phosphoribosyltransferase [decarboxylating] (EC 2.4.2.19)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation (EC 2.4.2.19)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72B31 at UniProt or InterPro

Protein Sequence (295 amino acids)

>DVU1807 nicotinate-nucleotide pyrophosphorylase (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MPHPDFTAFFSGTALDRLTAAIDLALVEDGPDLTSDAVFSPEDRLEAVVVAKQHTLVAGL
PIAPIILDRCPEVHPYTLEMPVRDGDRLAPGDTALRVAGSARHILKAERVILNFMTHLSG
IANLTHDYVTALEGTHTRLLDTRKTLPGLRHVEKYAVLVGGGLNHRIDLAEMLMLKDNHI
DAAGSITAAVTRLRTAYAPCPPIEVECRTMEEVAEAVACHVDRIMLDNMTPEAMRAALGI
IPRTIETETSGGVTLETIRSLALVGDRGPDFISVGRLTHSAPAADFSMRISKEHP