Protein Info for DVU1806 in Desulfovibrio vulgaris Hildenborough JW710

Name: mgtE
Annotation: magnesium transporter (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 456 transmembrane" amino acids 300 to 327 (28 residues), see Phobius details amino acids 369 to 388 (20 residues), see Phobius details amino acids 394 to 420 (27 residues), see Phobius details amino acids 432 to 455 (24 residues), see Phobius details TIGR00400: magnesium transporter" amino acids 39 to 455 (417 residues), 331.4 bits, see alignment E=4.4e-103 PF03448: MgtE_N" amino acids 40 to 140 (101 residues), 96.4 bits, see alignment E=2.7e-31 PF00571: CBS" amino acids 143 to 198 (56 residues), 28.7 bits, see alignment 2.8e-10 amino acids 210 to 262 (53 residues), 33.6 bits, see alignment 8.1e-12 PF01769: MgtE" amino acids 327 to 450 (124 residues), 101.1 bits, see alignment E=1.1e-32

Best Hits

KEGG orthology group: K06213, magnesium transporter (inferred from 100% identity to dvl:Dvul_1354)

Predicted SEED Role

"Mg/Co/Ni transporter MgtE / CBS domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72B32 at UniProt or InterPro

Protein Sequence (456 amino acids)

>DVU1806 magnesium transporter (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MKDEESGISEGRGRRHAPHEDMPAGDPCAGLVDTDTEYAHPADVAEHIENLSLEKQVCVL
RNLPAEDAAEALAELDEHVRVDLLENLDADVAAQILAEMSPDDAADVLDELDEDHRDVLL
NNLDTEDADEIRHLMAFDPDTAGGVMNTEIVILDEQLTADQAILQIRREIEDKENPYYAY
VVDIDDRLIGVLSLRDLLLSRPGVRLRDEVGNQNVISVLFDQDKEEVAHLLGHYNFMAMP
VVDYEGRILGVVTYDDIFDIIQEEASEDMLGMVGAAQDETVDTPWFESLVKRLPWLVVNM
LNSALSASVVYMFEGSIAQMAILAVLMPMVANQAGNTGQQALAVMIRQLAVDRFDSRKSW
RAVAREGKIGLASGVIMAVLVCAVIWAISGKGALAAVMGLALLCDMLLGAVAGGSIPLIF
RALGRDPAQASSIFLTAITDGAGFFIFLGLASLLLL