Protein Info for DVU1799 in Desulfovibrio vulgaris Hildenborough JW710

Name: fusA-2
Annotation: translation elongation factor G (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 682 TIGR00484: translation elongation factor G" amino acids 11 to 679 (669 residues), 732.2 bits, see alignment E=5.4e-224 PF00009: GTP_EFTU" amino acids 14 to 285 (272 residues), 204.8 bits, see alignment E=2.9e-64 TIGR00231: small GTP-binding protein domain" amino acids 15 to 163 (149 residues), 87 bits, see alignment E=1.2e-28 PF22042: EF-G_D2" amino acids 313 to 393 (81 residues), 50.9 bits, see alignment E=4.2e-17 PF03144: GTP_EFTU_D2" amino acids 327 to 393 (67 residues), 52.3 bits, see alignment E=1.8e-17 PF14492: EFG_III" amino acids 409 to 478 (70 residues), 86.8 bits, see alignment E=2.5e-28 PF03764: EFG_IV" amino acids 481 to 599 (119 residues), 51.1 bits, see alignment E=3.4e-17 PF00679: EFG_C" amino acids 602 to 679 (78 residues), 71.8 bits, see alignment E=1.2e-23

Best Hits

KEGG orthology group: K02355, elongation factor G (inferred from 100% identity to dvu:DVU1799)

Predicted SEED Role

"Translation elongation factor G-related protein" in subsystem Translation elongation factor G family

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72B39 at UniProt or InterPro

Protein Sequence (682 amino acids)

>DVU1799 translation elongation factor G (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MASSHGPAPRLELLRNIGIIAHIDAGKTTLSERILFYTQKIHRMGEVHDGTATMDFMPEE
QERGITIASACTTCTWGRHTVNIIDTPGHVDFTIEVERSLRVLDGAVGVFCAVGGVEPQS
ETVWRQSEKFGVPKLAFVNKMDRLGADFEATLDAMRTRLGAVPLPLVVPMGQGETFEGLV
DVVTREVLTFPADAHDRSYARAPVEGESARLCEVWRERMLETLAENDEGIVDRYLGGEEL
APEEIRAAIRRVTLARSLVPVFAGSALHNTGVQPLLDGVCAYLPSPVDAAPVRGLDRSEG
RRVVVSPEPKAPLAALVFKVVMEGSRKVALVRLYAGTLCEGDTCRNVTREVDERVSKLFR
LHAGRREQIEEAFAGDIVGVMGLRAARTGDTIAAAERPVLLENIAAYRPVISLAMEPRNT
EEGEKLDEVLERLCLEDPTLAVEQDEGTGQRILSGMGELHLEVVLERIRREYGVSPRVGN
PQVVFQETVSGTGEGAGEFDRELGDQPHYGQVSLRVTARERDKGNRVRFGMATEGWPQAW
VDSVAQGVVDSLQSGVVKGYPVQDVDVEVVSMQRRDGASSPAGYHMAAVAAVKAAMQSAG
PVLLEPIMAVEISVPEAHLGASIGQLGSRGGKVENMFDRGGQKVVQGLAPLAGLFGFSTA
LRSATQGRAGLVMRFERFDCME