Protein Info for DVU1797 in Desulfovibrio vulgaris Hildenborough JW710

Name: ksgA
Annotation: dimethyladenosine transferase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 266 TIGR00755: ribosomal RNA small subunit methyltransferase A" amino acids 4 to 258 (255 residues), 245.1 bits, see alignment E=3.7e-77 PF00398: RrnaAD" amino acids 5 to 255 (251 residues), 161.6 bits, see alignment E=1e-51

Best Hits

Swiss-Prot: 100% identical to RSMA_DESVH: Ribosomal RNA small subunit methyltransferase A (rsmA) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: K02528, 16S rRNA (adenine1518-N6/adenine1519-N6)-dimethyltransferase [EC: 2.1.1.182] (inferred from 100% identity to dvu:DVU1797)

Predicted SEED Role

"SSU rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))-dimethyltransferase (EC 2.1.1.182)" (EC 2.1.1.182)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.182

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72B41 at UniProt or InterPro

Protein Sequence (266 amino acids)

>DVU1797 dimethyladenosine transferase (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MPPRAKKSLGQNFLKDRNIAARIAAQLHIGPDDWVIEIGPGPGALTRHIHAAGPARLFLL
EKDHHWAREHRLHPLAGTPEAQVVLTDALLFPWERLDAAHPWKVIGNLPYNVASPLMWDI
CSRAPGLLRASFMIQKEVGERIVAAPGSRQYGALSVWLQCFTKPEWCFVVPPHVFTPRPK
VDSAVLAFTPRTDRPDAVQSKRLARVLRLCFQQRRKQLQGILRPHVGGDASALLAGLGID
PAARPETLSPERFIALGEAVAMSAIA