Protein Info for DVU1784 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: oxidoreductase, short-chain dehydrogenase/reductase family (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 253 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF08659: KR" amino acids 3 to 172 (170 residues), 47.9 bits, see alignment E=3.2e-16 PF00106: adh_short" amino acids 4 to 187 (184 residues), 190.4 bits, see alignment E=5.1e-60 PF01370: Epimerase" amino acids 5 to 178 (174 residues), 22 bits, see alignment E=2e-08 PF13561: adh_short_C2" amino acids 9 to 187 (179 residues), 136.5 bits, see alignment E=2.2e-43

Best Hits

Swiss-Prot: 62% identical to YDFG_SALTY: NADP-dependent 3-hydroxy acid dehydrogenase YdfG (ydfG) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K00540, [EC: 1.-.-.-] (inferred from 100% identity to dvu:DVU1784)

MetaCyc: 60% identical to 3-hydroxy acid dehydrogenase YdfG (Escherichia coli K-12 substr. MG1655)
RXN-16000 [EC: 1.1.1.381]; RXN-8974 [EC: 1.1.1.381, 1.1.1.298]; Serine 3-dehydrogenase. [EC: 1.1.1.381, 1.1.1.298, 1.1.1.276]

Predicted SEED Role

"Oxidoreductase, short chain dehydrogenase/reductase family" in subsystem Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.- or 1.1.1.276 or 1.1.1.298 or 1.1.1.381

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72B54 at UniProt or InterPro

Protein Sequence (253 amino acids)

>DVU1784 oxidoreductase, short-chain dehydrogenase/reductase family (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MQATICITGATAGFGEACARRFAAEGCRLIITGRRKERLEKLAAELGEDRCLPLVFDVRD
RKAVEAAFAALPEAFANVDVLINNAGLALGLEPAHRASLEDWETMIDTNLKGLMYCTRAL
LPGMVERGKGHVVNLGSIAGSYPYPGGNTYGATKAFVMQFSRNLRADLHGTGVRVTNIEP
GLAESEFSVIRFKGDASKAAGVYKGTEPLRPVDIADIIHFAVTCPAHVNINRIEVMPTCQ
SFGALPVHRTEAD