Protein Info for DVU1783 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: cysteine-rich domain protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02754: CCG
  • amino acids 11 to 93 (83 residues), 52.1 bits, E=3e-18
  • amino acids 140 to 224 (85 residues), 54.1 bits, E=7.2e-19

Best Hits

Swiss-Prot: 42% identical to LUTA_BACLD: Lactate utilization protein A (lutA) from Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46)

KEGG orthology group: K00104, glycolate oxidase [EC: 1.1.3.15] (inferred from 100% identity to dvu:DVU1783)

MetaCyc: 41% identical to iron-sulfur oxidase subunit used in L-lactate utilization (Bacillus subtilis subtilis 168)
L-lactate dehydrogenase. [EC: 1.1.1.27]

Predicted SEED Role

"Predicted L-lactate dehydrogenase, Fe-S oxidoreductase subunit YkgE" in subsystem Lactate utilization

MetaCyc Pathways

• homolactic fermentation (11/12 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (16/19 steps found)
• Bifidobacterium shunt (13/15 steps found)
• superpathway of anaerobic sucrose degradation (15/19 steps found)
• pyruvate fermentation to acetate and lactate II (4/4 steps found)
• pyruvate fermentation to (S)-lactate (1/1 steps found)
• pyruvate fermentation to acetate and (S)-lactate I (3/4 steps found)
• heterolactic fermentation (13/18 steps found)
• superpathway of glucose and xylose degradation (12/17 steps found)
• L-histidine degradation V (1/2 steps found)
• photorespiration I (6/9 steps found)
• (S)-lactate fermentation to propanoate, acetate and hydrogen (7/13 steps found)

KEGG Metabolic Maps

• Cysteine metabolism
• Glycolysis / Gluconeogenesis
• Glyoxylate and dicarboxylate metabolism
• Propanoate metabolism
• Pyruvate metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.27, 1.1.3.15

Use Curated BLAST to search for 1.1.1.27 or 1.1.3.15

Sequence Analysis Tools

See Q72B55 at UniProt or InterPro

Protein Sequence (250 amino acids)

>DVU1783 cysteine-rich domain protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MYTYPEDIKTVYFFGTCLVDMSFPDAGMAGIRLLQRAGVEVVFPAAQSCCGQPAYNSGFF
DEARTVALRQVEAFSAHDWPIVVPSGSCAGMMRFHYPELFAEAPDYFEVRRFSERVFELG
DFLCNALHQTYEDKGAPIKVTWHSSCHAMREMGAVAAAKTLIGQLANVELVDLPYEYECC
GFGGTFSIKQPELSGAMVSDKVANIRSTGAARVLSGDCGCLMNINGAMEKQSVPVQGQHL
ASFLWERING