Protein Info for DVU1782 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: iron-sulfur cluster-binding protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00273: iron-sulfur cluster-binding protein
  • amino acids 18 to 456 (439 residues), 491.2 bits, E=1.3e-151
• PF02589: LUD_dom
  • amino acids 69 to 293 (225 residues), 174.1 bits, E=6.8e-55
• PF13183: Fer4_8
  • amino acids 310 to 376 (67 residues), 42 bits, E=2.8e-14
• PF13534: Fer4_17
  • amino acids 311 to 376 (66 residues), 24.2 bits, E=9.5e-09
• PF11870: LutB_C
  • amino acids 384 to 471 (88 residues), 93.7 bits, E=1.8e-30

Best Hits

Swiss-Prot: 44% identical to LUTB_BACLD: Lactate utilization protein B (lutB) from Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46)

KEGG orthology group: None (inferred from 100% identity to dvl:Dvul_1376)

MetaCyc: 42% identical to component of an iron-sulfur oxidase linked to L-lactate utilization (Bacillus subtilis subtilis 168)
L-lactate dehydrogenase. [EC: 1.1.1.27]

Predicted SEED Role

"Predicted L-lactate dehydrogenase, Iron-sulfur cluster-binding subunit YkgF" in subsystem L-rhamnose utilization or Lactate utilization

MetaCyc Pathways

• homolactic fermentation (11/12 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (16/19 steps found)
• Bifidobacterium shunt (13/15 steps found)
• superpathway of anaerobic sucrose degradation (15/19 steps found)
• pyruvate fermentation to acetate and lactate II (4/4 steps found)
• pyruvate fermentation to (S)-lactate (1/1 steps found)
• pyruvate fermentation to acetate and (S)-lactate I (3/4 steps found)
• heterolactic fermentation (13/18 steps found)
• superpathway of glucose and xylose degradation (12/17 steps found)
• L-histidine degradation V (1/2 steps found)
• (S)-lactate fermentation to propanoate, acetate and hydrogen (7/13 steps found)

KEGG Metabolic Maps

• Cysteine metabolism
• Glycolysis / Gluconeogenesis
• Propanoate metabolism
• Pyruvate metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.27

Use Curated BLAST to search for 1.1.1.27

Sequence Analysis Tools

See Q72B56 at UniProt or InterPro

Protein Sequence (475 amino acids)

>DVU1782 iron-sulfur cluster-binding protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MASSTSIDFKGNVTGALADRQLRANFRSALDGLRAKRLNVFSDAEELDRMRVQGEANKRR
ALAQLPALLEQLEHRCTANGIIVHWAETTDEANRIVLDIMRSHDATTLVKGKSMVSEEMH
LNAYLERHGIEALETDLGEFIIQLNHEPPSHIIVPAVHKNRQQVARIFHEKLGEPYVDEV
EKLNAIARRTLREKFRTAQVGLSGVNFAIAETGTLLLVENEGNGRMCTTVPPVHIALMGL
EKVVERLEDVPPLLRLLTGSATGQLVTTYVNCITSPRKPGEKDGPREVHLVILDNGRSRM
LADPQLSRTLQCIRCGTCLNHCPVYVRIGGHAYDSVYPGPIGKILTPQIDGLARKGVLAT
ASSLCNACEEVCPVRIPIPALLRRLRRESYAPPGEGVVKGAGSKRTLFEKAVWKGWEMVY
SHPALYSFVLKVLGRFGHRLPKVGPLKAWTSVRTAPRFASTSLHELTRQEGIRHE