Protein Info for DVU1778 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: cation efflux family protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 481 transmembrane" amino acids 17 to 39 (23 residues), see Phobius details amino acids 45 to 66 (22 residues), see Phobius details amino acids 87 to 105 (19 residues), see Phobius details amino acids 120 to 137 (18 residues), see Phobius details amino acids 159 to 182 (24 residues), see Phobius details amino acids 196 to 216 (21 residues), see Phobius details TIGR01297: cation diffusion facilitator family transporter" amino acids 18 to 305 (288 residues), 215.5 bits, see alignment E=4.8e-68 PF01545: Cation_efflux" amino acids 22 to 225 (204 residues), 149.4 bits, see alignment E=1.2e-47 PF16916: ZT_dimer" amino acids 231 to 305 (75 residues), 62.7 bits, see alignment E=2.9e-21 amino acids 313 to 383 (71 residues), 27.1 bits, see alignment E=3.6e-10 amino acids 405 to 474 (70 residues), 53.3 bits, see alignment E=2.4e-18

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvl:Dvul_1379)

Predicted SEED Role

"Cobalt-zinc-cadmium resistance protein" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72B60 at UniProt or InterPro

Protein Sequence (481 amino acids)

>DVU1778 cation efflux family protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MSDDYTYIAEADREKRIAALSSVGAALLLTGLKLGVGFATNSLGILSEAAHSGLDLVAAV
VTYWAVRAASRPADADHPYGHGKVENLSALVETLLLLLTCGWIVREAVDRLFFEAVHVEP
SVWGLAVMGVSIVVDISRARMLRRVARKHNSQALEADALHFSTDVWSSAVVIAGLLALRA
AMFFPQDSFMFAVLQRADAFAALVVSCIVVFVSLQLGRRAVDVLLDGGAQEQVERAADAL
KDLPGIVRIERLRVRQSGPRTFVDLLLCVPQGMSFEASHTLSEQAERRLQAVLPQADVIV
HMEPASPDEVGMLERIRGVAASHGLAVHAVSFMLVDGEQHVDLHAEVAGEERLEVAHERV
SAFEADLARTLGKATVVTHIEPVAVREDALPEASNEALTAVEGVVHSLLDAEPDVDDCHN
MRLHRLGDELSLSFHCRMSPETPVSVAHEAATRLEKSLRARLGDISRVAIHMEPTPRNHQ
A