Protein Info for DVU1771 in Desulfovibrio vulgaris Hildenborough JW710

Name: hydC
Annotation: [Fe] hydrogenase gamma (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 606 PF13510: Fer2_4" amino acids 4 to 80 (77 residues), 57.9 bits, see alignment E=4.4e-19 PF00111: Fer2" amino acids 5 to 70 (66 residues), 33.7 bits, see alignment E=1.4e-11 PF10588: NADH-G_4Fe-4S_3" amino acids 88 to 124 (37 residues), 49.7 bits, see alignment 1e-16 PF22117: Fer4_Nqo3" amino acids 143 to 210 (68 residues), 30.6 bits, see alignment E=1.6e-10 TIGR02512: [FeFe] hydrogenase, group A" amino acids 144 to 519 (376 residues), 532.1 bits, see alignment E=3.4e-164 PF13183: Fer4_8" amino acids 149 to 208 (60 residues), 27.1 bits, see alignment 2.5e-09 PF12838: Fer4_7" amino acids 151 to 209 (59 residues), 30.7 bits, see alignment 1.8e-10 PF00037: Fer4" amino acids 193 to 210 (18 residues), 26.1 bits, see alignment (E = 2.9e-09) PF02906: Fe_hyd_lg_C" amino acids 230 to 515 (286 residues), 352.3 bits, see alignment E=1.1e-108 PF02256: Fe_hyd_SSU" amino acids 528 to 580 (53 residues), 66.9 bits, see alignment 6.5e-22

Best Hits

KEGG orthology group: K06441, ferredoxin hydrogenase gamma subunit [EC: 1.12.7.2] (inferred from 100% identity to dvl:Dvul_1384)

Predicted SEED Role

"Periplasmic [Fe] hydrogenase large subunit (EC 1.12.7.2)" in subsystem Hydrogenases (EC 1.12.7.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.12.7.2

Use Curated BLAST to search for 1.12.7.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72B67 at UniProt or InterPro

Protein Sequence (606 amino acids)

>DVU1771 [Fe] hydrogenase gamma (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MNAFINGKEVRCEPGRTILEAARENGHFIPTLCELADIGHAPGTCRVCLVEIWRDKEAGP
QIVTSCTTPVEEGMRIFTRTPEVRRMQRLQVELLLADHDHDCAACARHGDCELQDVAQFV
GLTGTRHHFPDYARSRTRDVSSPSVVRDMGKCIRCLRCVAVCRNVQGVDALVVTGNGIGT
EIGLRHNRSQSASDCVGCGQCTLVCPVGALAGRDDVERVIDYLYDPEIVTVFQFAPAVRV
GLGEEFGLPPGSSVEGQVPTALRLLGADVVLDTNFAADLVIMEEGTELLQRLRGGAKLPL
FTSCCPGWVNFAEKHLPDILPHVSTTRSPQQCLGALAKTYLARTMNVAPERMRVVSLMPC
TAKKEEAARPEFRRDGVRDVDAVLTTREFARLLRREGIDLAGLEPSPCDDPLMGRATGAA
VIFGTTGGVMEAALRTVYHVLNGKELAPVELHALRGYENVREAVVPLGEGNGSVKVAVVH
GLKAARQMVEAVLAGKADHVFVEVMACPGGCMDGGGQPRSKRAYNPNAQARRAALFSLDA
ENALRQSHNNPLIGKVYESFLGEPCSNLSHRLLHTRYGDRKSEVAYTMRDIWHEMTLGRR
VRGDSD