Protein Info for DVU1766 in Desulfovibrio vulgaris Hildenborough JW710

Name: aspA
Annotation: aspartate ammonia-lyase, putative (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 470 PF00206: Lyase_1" amino acids 19 to 344 (326 residues), 265.1 bits, see alignment E=1e-82 PF10415: FumaraseC_C" amino acids 414 to 464 (51 residues), 45.9 bits, see alignment 6.2e-16

Best Hits

Swiss-Prot: 47% identical to ASPA_PSEAE: Aspartate ammonia-lyase (aspA) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K01744, aspartate ammonia-lyase [EC: 4.3.1.1] (inferred from 100% identity to dvu:DVU1766)

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.3.1.1

Use Curated BLAST to search for 4.3.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72B70 at UniProt or InterPro

Protein Sequence (470 amino acids)

>DVU1766 aspartate ammonia-lyase, putative (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MSLSDQDAIRIEHDLLGDCAVPRTALHGAHTQRALSNVALSGRPLHPEIIRAFGAVKRAC
ARTNMNLGHLSREVAEAIIMACDELEDGGLGEHIVVDALQGGAGTSANMNVNEVLANRAE
EMLGGTRGQYQLVDPLAHVNLHQSTNDVFPTAVRIAALRLLARLEPAIAALQSAFQTHEA
SFAQVVRLGRTQLQDAVPMTFGAACGAWAEALSRDRWRVFKCSERLRVVNLGGTAIGTGI
AAPRSYILSVVDRLREDTGLPLARAENLMDATQNVDAFVEVSGILKAHASNLLKLSSDLR
LLASGPGGGIGEVVLPPVQAGSSIMPGKVNPVVCETVAQAAMQATANDLAITLSAQHGQL
ELNAFMPLIADALLHGIELLTNACDLFRTRCVEGLHPDTETCARHVSTSTATLTALVPEI
GYAAASEMARHMREHGTDVFGAAKATGLIDEDRLARLLSPERLVALGYRG