Protein Info for DVU1684 in Desulfovibrio vulgaris Hildenborough JW710

Name: gcvT
Annotation: glycine cleavage system T protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 376 TIGR00528: glycine cleavage system T protein" amino acids 21 to 343 (323 residues), 289.8 bits, see alignment E=1.4e-90 PF01571: GCV_T" amino acids 23 to 268 (246 residues), 299.7 bits, see alignment E=1.5e-93 PF08669: GCV_T_C" amino acids 290 to 365 (76 residues), 54.4 bits, see alignment E=9.6e-19

Best Hits

Swiss-Prot: 42% identical to GCST_SYNR3: Aminomethyltransferase (gcvT) from Synechococcus sp. (strain RCC307)

KEGG orthology group: K00605, aminomethyltransferase [EC: 2.1.2.10] (inferred from 100% identity to dvl:Dvul_1403)

Predicted SEED Role

"Aminomethyltransferase (glycine cleavage system T protein) (EC 2.1.2.10)" in subsystem Glycine and Serine Utilization or Glycine cleavage system or Photorespiration (oxidative C2 cycle) (EC 2.1.2.10)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.2.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72BF2 at UniProt or InterPro

Protein Sequence (376 amino acids)

>DVU1684 glycine cleavage system T protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MTHTTLQPSDKETELSDLLLTPLNAWHRAQGAKMAPFAGWDMPIQYEGILAEHQHTRTHA
ALFDICHMGEFALRGPGAKQALARAVTHNLETLKPGRCRYGFLLNEAGCVLDDLIVYCLA
EDDYMLVVNGACIASDFAALRERLPASLHFEDISAATAKLDLQGPKSIDALEGLLGRSFR
ELGYFAFTHTTFDGANLMVSRTGYTGELGYELYLPWDKAETLWTRLLENADVKPAGLGAR
DTLRLEVGLPLYGQDLDTTHTPAEAGYEGMLTNTVDYVGKGRDREVREVLVPLAIPGRRA
ARHGDAVALPDGTVVGVVTSGSFAPSVGHAVALAYVKKPHAEEDSFIIKAARVELEAKRA
PLPFYAGGTARMKLQG