Protein Info for DVU1678 in Desulfovibrio vulgaris Hildenborough JW710

Name: rimI
Annotation: ribosomal-protein-alanine acetyltransferase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 164 TIGR01575: ribosomal-protein-alanine acetyltransferase" amino acids 22 to 150 (129 residues), 114.5 bits, see alignment E=1.9e-37 PF00583: Acetyltransf_1" amino acids 25 to 131 (107 residues), 70.7 bits, see alignment E=3.8e-23 PF13480: Acetyltransf_6" amino acids 32 to 110 (79 residues), 23.4 bits, see alignment E=1.8e-08 PF13673: Acetyltransf_10" amino acids 32 to 135 (104 residues), 44.5 bits, see alignment E=4.4e-15 PF13420: Acetyltransf_4" amino acids 45 to 146 (102 residues), 26.7 bits, see alignment E=1.6e-09 PF13508: Acetyltransf_7" amino acids 53 to 132 (80 residues), 50.2 bits, see alignment E=8.3e-17 PF08445: FR47" amino acids 64 to 134 (71 residues), 39.5 bits, see alignment E=1.3e-13

Best Hits

KEGG orthology group: K03789, ribosomal-protein-alanine N-acetyltransferase [EC: 2.3.1.128] (inferred from 100% identity to dvu:DVU1678)

Predicted SEED Role

"Ribosomal-protein-S18p-alanine acetyltransferase (EC 2.3.1.-)" in subsystem Bacterial RNA-metabolizing Zn-dependent hydrolases or Conserved gene cluster associated with Met-tRNA formyltransferase or Ribosome biogenesis bacterial (EC 2.3.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.- or 2.3.1.128

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72BF8 at UniProt or InterPro

Protein Sequence (164 amino acids)

>DVU1678 ribosomal-protein-alanine acetyltransferase (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MVGDTSRGAQSATFVRLGREDMGEVAALEQACFSTPWSEEQFLLAFEQRIFSVFALRDQE
RIVAYAAVYHAAGELEILNIAVHPDRRRHGLGRRLLGILLQVAVKMGITRAVLEVRTGNT
PAIGLYEALGFRRIGVRPHYYQDTGEDALIFECDLADGSDACTA