Protein Info for DVU1677 in Desulfovibrio vulgaris Hildenborough JW710

Name: tpiA
Annotation: triosephosphate isomerase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00121: TIM
  • amino acids 3 to 249 (247 residues), 279.6 bits, E=1.2e-87
• TIGR00419: triose-phosphate isomerase
  • amino acids 4 to 242 (239 residues), 156.3 bits, E=5.5e-50

Best Hits

Swiss-Prot: 100% identical to TPIS_DESVV: Triosephosphate isomerase (tpiA) from Desulfovibrio vulgaris subsp. vulgaris (strain DP4)

KEGG orthology group: K01803, triosephosphate isomerase (TIM) [EC: 5.3.1.1] (inferred from 100% identity to dvl:Dvul_1410)

Predicted SEED Role

"Triosephosphate isomerase (EC 5.3.1.1)" in subsystem Calvin-Benson cycle or Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes or MLST (EC 5.3.1.1)

MetaCyc Pathways

• homolactic fermentation (11/12 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (16/19 steps found)
• glycolysis II (from fructose 6-phosphate) (10/11 steps found)
• glycolysis III (from glucose) (10/11 steps found)
• glycolysis I (from glucose 6-phosphate) (11/13 steps found)
• formaldehyde assimilation III (dihydroxyacetone cycle) (10/12 steps found)
• superpathway of anaerobic sucrose degradation (15/19 steps found)
• glycolysis IV (8/10 steps found)
• Calvin-Benson-Bassham cycle (10/13 steps found)
• gluconeogenesis I (10/13 steps found)
• gluconeogenesis III (9/12 steps found)
• glycolysis VI (from fructose) (8/11 steps found)
• glycolysis V (Pyrococcus) (7/10 steps found)
• superpathway of glycolysis and the Entner-Doudoroff pathway (12/17 steps found)
• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (18/26 steps found)
• superpathway of N-acetylneuraminate degradation (15/22 steps found)
• ethene biosynthesis V (engineered) (17/25 steps found)
• oxygenic photosynthesis (11/17 steps found)
• sucrose degradation V (sucrose α-glucosidase) (2/5 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (14/22 steps found)
• superpathway of hexitol degradation (bacteria) (11/18 steps found)
• glycerol degradation to butanol (9/16 steps found)
• gluconeogenesis II (Methanobacterium thermoautotrophicum) (9/18 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (15/27 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (14/26 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (22/56 steps found)

KEGG Metabolic Maps

• Carbon fixation in photosynthetic organisms
• Fructose and mannose metabolism
• Glycolysis / Gluconeogenesis
• Inositol phosphate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.1.1

Sequence Analysis Tools

See Q72BF9 at UniProt or InterPro

Protein Sequence (251 amino acids)

>DVU1677 triosephosphate isomerase (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MKKLIAANWKMYKTIDEARATGRELVSAVAGSLPADREVLVCPPFTALHALHDTFKDVEG
FAIGGQDVYPATEGAYTGEIAPGMLLDAGCGWVLTGHSERRHILGEDDETVARKTAFSLK
AGLRVVLCIGEKLDEREAGRLEDVLAHQLQVGLADVDATYVPQSLVVAYEPVWAIGTGKV
AGPAEVVEAHALVRSLLEARYGRDGAAIRILYGGSVKPDNAAELLSLDNVDGLLVGGASL
QAVSFSRIILA