Protein Info for DVU1671 in Desulfovibrio vulgaris Hildenborough JW710

Name: msbA
Annotation: ABC transporter, ATP-binding protein/permease protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 601 transmembrane" amino acids 27 to 50 (24 residues), see Phobius details amino acids 65 to 83 (19 residues), see Phobius details amino acids 145 to 163 (19 residues), see Phobius details amino acids 169 to 187 (19 residues), see Phobius details amino acids 251 to 271 (21 residues), see Phobius details amino acids 282 to 299 (18 residues), see Phobius details PF00664: ABC_membrane" amino acids 31 to 295 (265 residues), 182.2 bits, see alignment E=1.7e-57 PF00005: ABC_tran" amino acids 361 to 510 (150 residues), 117.9 bits, see alignment E=5.2e-38

Best Hits

Swiss-Prot: 38% identical to MSBA_YERPS: Lipid A export ATP-binding/permease protein MsbA (msbA) from Yersinia pseudotuberculosis serotype I (strain IP32953)

KEGG orthology group: K11085, ATP-binding cassette, subfamily B, bacterial MsbA [EC: 3.6.3.-] (inferred from 100% identity to dvl:Dvul_1416)

Predicted SEED Role

No annotation

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72BG5 at UniProt or InterPro

Protein Sequence (601 amino acids)

>DVU1671 ABC transporter, ATP-binding protein/permease protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MGEPSTTQRASLPLLRRIGRYFLPHKVSIALSMGCMAIVSATTAGTAYLIKPALDDIFIN
KDEQALLLVPAFFIVLTALKGFGRYFQNYFMNYAGLRVIESLRDQLFTKIIHLPMRFYED
SQIGLLMSRIINDVSMIRDSLPSTVMIVRQILTMVGLIGVVFYQNAELATWAVLVLPLAL
YPFIYFGRKLRKLGRRNQEKLADISVILQEVFSGIRVVKAFATEKEEAHRFDAENQRLVK
LTLKQICVSELSSPVMELIGALGIGLVILYGGHEVISGKTTPGTFFSFMAALVMLYDPIK
SLSMANREVQRALVGAERVFEILDAEDLCIETSGDLKFNRDFKEVCIKDVSFAYADGSPA
LRDINLCVRAGERVAIVGPSGAGKTTLVNLIPRFYEPSSGCIEIDGVPLQDFDLADLRRS
ISVVSQDAFLFNLSVSDNITYGTPNVGAGRIEAAAHAAFAHEFVQQLAQGYDTVLGERGV
KLSGGQKQRLTIARALLKDAPLLILDEATSALDSQAERIVQKALDNLMENRTSIVIAHRL
STVLNADRIVVMEDGRVVDQGPHAELLGRCELYTRLYSIQFGQEKADADRIDGTSEEKLE
A