Protein Info for DVU1655 in Desulfovibrio vulgaris Hildenborough JW710

Name: aspC4
Annotation: aminotransferase, classes I and II (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 388 TIGR03540: LL-diaminopimelate aminotransferase" amino acids 5 to 387 (383 residues), 621.2 bits, see alignment E=3.2e-191 PF00155: Aminotran_1_2" amino acids 34 to 385 (352 residues), 234.5 bits, see alignment E=1.1e-73

Best Hits

Swiss-Prot: 100% identical to DAPAT_DESVH: LL-diaminopimelate aminotransferase (dapL) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: K10206, LL-diaminopimelate aminotransferase [EC: 2.6.1.83] (inferred from 100% identity to dvl:Dvul_1431)

MetaCyc: 42% identical to glutamate--pyruvate aminotransferase AlaC (Escherichia coli K-12 substr. MG1655)
Alanine transaminase. [EC: 2.6.1.2]

Predicted SEED Role

"LL-diaminopimelate aminotransferase (EC 2.6.1.83), predicted alternative" (EC 2.6.1.83)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.6.1.2 or 2.6.1.83

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72BI1 at UniProt or InterPro

Protein Sequence (388 amino acids)

>DVU1655 aminotransferase, classes I and II (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MAAFKLADRLATLPPYLFAGIDKVKAEVAARGVDIISLGIGDPDMATPGFIIEAMKEAIA
RPANHQYPSYVGMLAFRQEVANWYDRRFGVSLDPATEVIGLIGSKEGIAHFPFAFINPGD
LVLVCTPNYPVYHIATGFAGGEVQFVPLLEENDFLPDLDAIPEDTWKRAKMIFVNYPNNP
TAATAPLGFYEKLVDICRRFDVIIAHDTAYTEIYYDEDNRPPSILSVPGAKDVAIEFHSL
SKTYNMTGWRVGMAVGNPTLVAGLGKIKENMDSGIFQAVQEASIVALRDGDDFCRELRGI
YRQRRDTVINALHKAGIQCRVPQATFYVWARVPQGHTSADFVTRVLQETGVVVTPGNGFG
TPGEGFFRISLTVDNARLEEAVSRIAKL