Protein Info for DVU1649 in Desulfovibrio vulgaris Hildenborough JW710

Name: mutS
Annotation: DNA mismatch repair protein MutS (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 905 TIGR01070: DNA mismatch repair protein MutS" amino acids 8 to 895 (888 residues), 934.8 bits, see alignment E=2.7e-285 PF01624: MutS_I" amino acids 9 to 120 (112 residues), 152.3 bits, see alignment E=1.4e-48 PF05188: MutS_II" amino acids 129 to 257 (129 residues), 57.1 bits, see alignment E=6.5e-19 PF05192: MutS_III" amino acids 275 to 582 (308 residues), 141.7 bits, see alignment E=9.5e-45 PF05190: MutS_IV" amino acids 451 to 541 (91 residues), 93.9 bits, see alignment E=1.6e-30 PF00488: MutS_V" amino acids 634 to 823 (190 residues), 273.6 bits, see alignment E=2.4e-85

Best Hits

Swiss-Prot: 100% identical to MUTS_DESVH: DNA mismatch repair protein MutS (mutS) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: K03555, DNA mismatch repair protein MutS (inferred from 100% identity to dvl:Dvul_1437)

Predicted SEED Role

"DNA mismatch repair protein MutS" in subsystem DNA repair, bacterial MutL-MutS system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P61666 at UniProt or InterPro

Protein Sequence (905 amino acids)

>DVU1649 DNA mismatch repair protein MutS (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MTNPSPKLTPMFEQYLRIKEDYPDALLFYRMGDFYELFFDDAETTARELQIALTCRNPNA
ELKAPMCGVPYHAVEGYISQLLDKGYRVAICEQIEDPKEAKGLVKRAVTRVLTPGTVIDD
ANLDAKEHNYLGALFWNQDAEAGAFAWVDVSTGEWSGLYSRKLAELWQWAQKMAPRELLL
PEGVDTPAMATLGTTQTVRVPARSHFDLKSGTERVMRAQGVADLGSLGLEGKPELVRACA
ALLAYLAQTQKQELSHLAPFKPLNLGRHLIIDEVTERNLELFHRLDGRKGPGTLWHILDR
TLTPMGGRLLEERMHHPWREASPIRETQQVVEWLFQDDVRREALRTALDLVYDLERLSTR
IFLNRATPKDFIALRQSLSALPAVRATLERPANPEGTYPTDAETSGDTLPKPLSDMLSAW
DDLADYADLLRRALTDNPPHLVTEGGLFRPGFDPDLDELLDLAEHGEARLQELLAEEQTV
SGLPKLKLGYNRVFGYFFELSRAGADSVPEHFVRRQTLANAERFTTERLKELEEKLVSAT
DRRKTLEYRLFQSLRDTVAEARPRVLFMADMLAHLDFWQSLADVARRNGWVRPDVHTGHD
IVIREGRHPVVEAMQGSASFVPNDLRMDEKRRLLLITGPNMAGKSTVLRQTAIICLLAQM
GAFVPAREASIGIADRIFSRVGASDNLAQGQSTFMVEMMETARILRQASKRSLVILDEIG
RGTSTFDGMALAWAVVEELTRRAGGGIRTLFATHYHEITSLEGRIPGVHNMNIAIREWNG
DIVFLRRLVPGPADKSYGIEVARLAGVPHSVVQRARELLADLERTRDAARGTNSAPSRQT
LPGLDLPSKQEQVDTIVAPPPCSGVEHPLLVALRDIDTDDMTPLEALKRITEWKQLWGTT
REDRS