Protein Info for DVU1630 in Desulfovibrio vulgaris Hildenborough JW710

Name: ptsN
Annotation: PTS system, IIA component (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 149 PF00359: PTS_EIIA_2" amino acids 6 to 148 (143 residues), 109.3 bits, see alignment E=8.5e-36

Best Hits

Swiss-Prot: 36% identical to PTSN_PSEAE: Nitrogen regulatory protein (ptsN) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02806, PTS system, nitrogen regulatory IIA component [EC: 2.7.1.69] (inferred from 99% identity to dvl:Dvul_1503)

Predicted SEED Role

"PTS system, fructose-specific IIA component (EC 2.7.1.69) / PTS system, fructose-specific IIB component (EC 2.7.1.69) / PTS system, fructose-specific IIC component (EC 2.7.1.69)" in subsystem Fructose utilization (EC 2.7.1.69)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.69

Use Curated BLAST to search for 2.7.1.69

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72BK5 at UniProt or InterPro

Protein Sequence (149 amino acids)

>DVU1630 PTS system, IIA component (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MRLDEYLSKDLIIHEISASTKEEVLAELVNAVCRAHPEVDGRAALKVLHEREQLGTTGIG
DGIAIPHGKLSDLGRIVLSVGRSSAGFGFDSLDGKPVHIVFLVLAPEHVAGMHLRVLAHI
SRLLKDVAFRRALIEAPDANAMWELLSKA