Protein Info for DVU1599 in Desulfovibrio vulgaris Hildenborough JW710

Name: crcB
Annotation: crcB protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 124 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 32 to 55 (24 residues), see Phobius details amino acids 67 to 85 (19 residues), see Phobius details amino acids 97 to 119 (23 residues), see Phobius details TIGR00494: protein CrcB" amino acids 6 to 118 (113 residues), 88.7 bits, see alignment E=1.8e-29 PF02537: CRCB" amino acids 6 to 117 (112 residues), 94.1 bits, see alignment E=3.1e-31

Best Hits

Swiss-Prot: 100% identical to CRCB_DESVH: Putative fluoride ion transporter CrcB (crcB) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: K06199, CrcB protein (inferred from 100% identity to dvl:Dvul_1535)

Predicted SEED Role

"CrcB protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72BN6 at UniProt or InterPro

Protein Sequence (124 amino acids)

>DVU1599 crcB protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MHRFVLVATGGIFGSLARYVLSGVAQKLTTSSFPYGTVLVNLLGSLLFGLVWGILENRIT
FAPEARLLLLTGFMGSLTTFSTLTYEGMVLLQSHMWLQAALYIVGQTVAGIMLVWFGAGL
GRLV