Protein Info for DVU1580 in Desulfovibrio vulgaris Hildenborough JW710

Name: rpiB
Annotation: ribose 5-phosphate isomerase, putative (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01120: ribose 5-phosphate isomerase B
  • amino acids 4 to 141 (138 residues), 182.4 bits, E=4.4e-58
• PF02502: LacAB_rpiB
  • amino acids 5 to 139 (135 residues), 192.5 bits, E=1.6e-61
• TIGR00689: sugar-phosphate isomerase, RpiB/LacA/LacB family
  • amino acids 5 to 140 (136 residues), 181.1 bits, E=1.1e-57

Best Hits

Swiss-Prot: 46% identical to RPIB_ECOLI: Ribose-5-phosphate isomerase B (rpiB) from Escherichia coli (strain K12)

KEGG orthology group: K01808, ribose 5-phosphate isomerase B [EC: 5.3.1.6] (inferred from 100% identity to dvl:Dvul_1553)

Predicted SEED Role

"Ribose 5-phosphate isomerase B (EC 5.3.1.6)" in subsystem Calvin-Benson cycle or D-ribose utilization or LMPTP YwlE cluster or Pentose phosphate pathway (EC 5.3.1.6)

MetaCyc Pathways

• Bifidobacterium shunt (13/15 steps found)
• pentose phosphate pathway (non-oxidative branch) II (6/6 steps found)
• pentose phosphate pathway (non-oxidative branch) I (5/5 steps found)
• formaldehyde assimilation III (dihydroxyacetone cycle) (10/12 steps found)
• Rubisco shunt (8/10 steps found)
• Calvin-Benson-Bassham cycle (10/13 steps found)
• pentose phosphate pathway (6/8 steps found)
• superpathway of glucose and xylose degradation (12/17 steps found)
• formaldehyde assimilation II (assimilatory RuMP Cycle) (6/9 steps found)
• ethene biosynthesis V (engineered) (17/25 steps found)
• oxygenic photosynthesis (11/17 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (15/27 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (14/26 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of plant hormones
• Carbon fixation in photosynthetic organisms
• Pentose phosphate pathway

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.1.6

Sequence Analysis Tools

See Q72BQ4 at UniProt or InterPro

Protein Sequence (147 amino acids)

>DVU1580 ribose 5-phosphate isomerase, putative (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MARKVFVGSDHAGFALKQSIVDSLRNAGHDVEDLGPESAVSCDYPHYAQKVCDRVLAEEA
LGILICGTGIGMSMAANRIPGIRAALCTCEFHARATRQHNNANVLCLGERVTGPGVALEL
ARLFLDTDFEGGRHQRRIDLFDLNGCR