Protein Info for DVU1568 in Desulfovibrio vulgaris Hildenborough JW710

Name: ftn
Annotation: ferritin (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 169 PF00210: Ferritin" amino acids 8 to 144 (137 residues), 159.7 bits, see alignment E=2.3e-51

Best Hits

Swiss-Prot: 45% identical to FTN_BACF6: Bacterial non-heme ferritin (ftnA) from Bacteroides fragilis (strain 638R)

KEGG orthology group: K02217, ferritin [EC: 1.16.3.1] (inferred from 100% identity to dvu:DVU1568)

MetaCyc: 39% identical to ferritin iron storage protein (Escherichia coli K-12 substr. MG1655)
RXN-15294 [EC: 1.16.3.2]

Predicted SEED Role

"Ferritin-like protein 2"

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.16.3.1 or 1.16.3.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72BR6 at UniProt or InterPro

Protein Sequence (169 amino acids)

>DVU1568 ferritin (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MLSQRMNDALNEQVKWELYSSYMYLSMSSYFLDKGLAGFANWMRIQAQEELFHAMRFFDF
IGERGGRAVLHPVDAPPAEWKNPLDAFTHTLEHERLVTSRINDLVNVAIEEKDHATNIFL
QWFVTEQVEEEDSVNDVLNKLRLINGEGQGMLMLDKDLATRVFTPPTTA