Protein Info for DVU1566 in Desulfovibrio vulgaris Hildenborough JW710

Name: cysD
Annotation: phosphoadenosine phosphosulfate reductase, putative (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 224 PF01507: PAPS_reduct" amino acids 27 to 196 (170 residues), 136.1 bits, see alignment E=6.8e-44

Best Hits

KEGG orthology group: K00390, phosphoadenosine phosphosulfate reductase [EC: 1.8.4.8] (inferred from 100% identity to dvu:DVU1566)

Predicted SEED Role

"Sulfate adenylyltransferase subunit 2 (EC 2.7.7.4)" in subsystem Cysteine Biosynthesis (EC 2.7.7.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.4

Use Curated BLAST to search for 1.8.4.8 or 2.7.7.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72BR8 at UniProt or InterPro

Protein Sequence (224 amino acids)

>DVU1566 phosphoadenosine phosphosulfate reductase, putative (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
VEGLELKVARARRVLLEVAHTWKPQDVAVAWTGGKDSTVALSLWQRVLDEAHPGMRAKAL
SLDTGCKFPEVVAFRDRMAQEWSIDLTVVRPDVGPDYPVAVDRVACCRDLKVEPLLRALK
EREIAVLLTGVRADENPERASRPQTETFDAPSHVRVHPVLEFSEMDIWAYTMAQGLPYCT
LYAQGYRSLGCVPCTSLVVGGDERAGRDATKEASMDALHALGYF