Protein Info for DVU1558 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: cysteine-rich domain/iron-sulfur cluster-binding domain protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 797 PF14691: Fer4_20" amino acids 10 to 92 (83 residues), 51.8 bits, see alignment E=1.4e-17 PF13183: Fer4_8" amino acids 317 to 383 (67 residues), 35.4 bits, see alignment E=2.5e-12 PF13534: Fer4_17" amino acids 320 to 385 (66 residues), 54.3 bits, see alignment E=3.2e-18 PF02754: CCG" amino acids 479 to 526 (48 residues), 23.3 bits, see alignment 1.1e-08 amino acids 564 to 645 (82 residues), 28 bits, see alignment E=4e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvu:DVU1558)

Predicted SEED Role

"FAD-dependent pyridine nucleotide-disulphide oxidoreductase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72BS6 at UniProt or InterPro

Protein Sequence (797 amino acids)

>DVU1558 cysteine-rich domain/iron-sulfur cluster-binding domain protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MDQSELRQWESRCTQEEPPRCRAACPLHVDVRAFCTHMAEGDLRKAWGVLCRTLPLPTLL
ARICDQPCRNACLRNEAGGGLHIAGLERACAEASGRPAPAPPMPRRGLDAVILGGDLAGL
AAAWDLSRKGITVALHTLSTAEAILDGLRRPAGHAILDTLSAHLAEEVDTLRRMGVTIHE
GPLPPSQAIDEWGASGHAVFIAPVAYPLYCEEDQPPDVVTLGTATPGVFAAIPPARPGDS
ERPDETAPGHSPVEMAALGRRAATSMERFLQKVSLVAGREREGVFSARLFTSLADVVPLS
PVVEPPEGYTADEARREAARCIRCECMECVRHCAYLAEYGGYPKQYARRIYNNESIVMGT
RQANTMIDSCMMCGLCATVCPEGFDMGALCLDARRSMVHRDKMPPSAHEFALRDMAFANS
GTCVVARHEAEKQNSTWLFFPGCQLTASAPGLVESTWCWLQRWLPAIDDAKRSGVGLLAH
CCGAPAHWAGREQLHQDTLHTVESHWEELGRPILVTACPSCATTLRNGLPHIPVETLWEK
MAEVADKHGLEPFGTPHPWKGDLVLHDPCGTREDEPLRNAVRALLVALGVEYREPALTRE
RTECCGFGGLVAEANPPLADKLTRGRAERLSAMGTHAVTYCAMCRDRLVKAGTPTAHMLN
LFFSTPDTTLEDCTPPAPGYSQRRENRVALCERLKGRSADAQPAPAWASIPVHYTEKAAA
LMEERRILDSDVRKVLHHAMQSGRWIDDTNDEGVRIACFRPVVVTYWVAYTIDADGVPLV
RNVWCHRMHVIDAGGRQ