Protein Info for DVU1549 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: conserved hypothetical protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 PF13489: Methyltransf_23" amino acids 27 to 178 (152 residues), 38.5 bits, see alignment E=3.4e-13 PF01209: Ubie_methyltran" amino acids 34 to 156 (123 residues), 36.4 bits, see alignment E=1.3e-12 PF13847: Methyltransf_31" amino acids 35 to 147 (113 residues), 47.8 bits, see alignment E=4.9e-16 PF08003: Methyltransf_9" amino acids 35 to 139 (105 residues), 25.4 bits, see alignment E=2.4e-09 PF13649: Methyltransf_25" amino acids 38 to 132 (95 residues), 67.4 bits, see alignment E=5.3e-22 PF08242: Methyltransf_12" amino acids 39 to 134 (96 residues), 40.1 bits, see alignment E=1.8e-13 PF08241: Methyltransf_11" amino acids 39 to 136 (98 residues), 64.3 bits, see alignment E=4.7e-21

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvu:DVU1549)

Predicted SEED Role

"probable transcription regulator VCA0264"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72BT5 at UniProt or InterPro

Protein Sequence (250 amino acids)

>DVU1549 conserved hypothetical protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MDLMFRLYEGLERLGPGSAASTARALALAGALPAGARILDIGCGTGAQTLDLLRQCDCHV
TAVDMHQPFLDSLMARAEGAGLASRVRTLCADMNALELPDGAYDVLWSEGAIYHMGFDVG
LTQWRRLLRPEGVLVVSEMSWFVDSPPQDALDFWREGYPQMRHENANAEAMERHGYELLG
SFRLPVADWWDVYYADLTVRLEAFETLYGSTEEGRAIIDEQRREFDVMRRGGDSCGYVFY
VARKHGQGVC