Protein Info for DVU1547 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: sensory box protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 541 TIGR00229: PAS domain S-box protein" amino acids 119 to 211 (93 residues), 36.4 bits, see alignment E=2.5e-13 PF13426: PAS_9" amino acids 121 to 212 (92 residues), 42.9 bits, see alignment E=1.3e-14 amino acids 242 to 339 (98 residues), 26.7 bits, see alignment E=1.4e-09 PF00989: PAS" amino acids 126 to 214 (89 residues), 29.1 bits, see alignment E=2.2e-10 amino acids 228 to 338 (111 residues), 24.7 bits, see alignment E=4.9e-09 PF08447: PAS_3" amino acids 133 to 212 (80 residues), 28.7 bits, see alignment E=3.2e-10 PF08448: PAS_4" amino acids 233 to 341 (109 residues), 48.9 bits, see alignment E=1.8e-16 PF07022: Phage_CI_repr" amino acids 475 to 533 (59 residues), 45.3 bits, see alignment 2.2e-15

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvu:DVU1547)

Predicted SEED Role

"Sensory box histidine kinase/response regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72BT7 at UniProt or InterPro

Protein Sequence (541 amino acids)

>DVU1547 sensory box protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MTLNELVDFYRPRLDASPDLGLLLDGHGNVLHANGPLRSLFDEGYTSAQPEGVARQLLDN
MRTSERDTAAPVHETRLRMALPDGAGIRQVDWKTLTIPAAEGRLLLAWGRLRTTEGGREM
GFTILPNGNISAVSPMLSAICGYAPDELIGRPARQFYYTDTARRRVVSQLLEKKEVENGE
VTLRRKDGSPLILWYSAESIRDASGSMVAYSGYFQQRPFVFSSKLANDFARIVDALPGVA
WVCGRDLRIVAVNDSYLEAYNRNRNDVIGRTEHDFLPAEQARYLVEAALRVFEEKQELLH
PAVPHLLDPAVWFRTVRRPIFDDARQEVIGLLGIAQDISGKVRQENVFMEQLRATESDVV
VVTDDQGRILRRSLQTLSPSIFGKREPFEAYTLDMRPVLDLLDVDDLPKVRQALHAALRE
HREQHIECRIRNLTGSYTTVLARLVFNDTIYGEPRMYVVARDIGGEMELRQASMVIERLK
EAARAKTDRELARFLNVSAASISNARKNDRVPPDWIIDTGLRTGRSIDWLVRGMQQDGGC
R