Protein Info for DVU1503 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: terminase, large subunit (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 565 PF03354: TerL_ATPase" amino acids 91 to 260 (170 residues), 87.8 bits, see alignment E=7.3e-29 PF20441: TerL_nuclease" amino acids 272 to 550 (279 residues), 178.3 bits, see alignment E=2e-56

Best Hits

Swiss-Prot: 51% identical to TERL_BPSF5: Putative terminase large subunit (2) from Shigella phage SfV

KEGG orthology group: None (inferred from 100% identity to dvu:DVU1503)

Predicted SEED Role

"Phage terminase, large subunit"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72BY1 at UniProt or InterPro

Protein Sequence (565 amino acids)

>DVU1503 terminase, large subunit (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MAKVSKESSHPHVDAGLQYARDVVAGRTLACKWVRLACKRQLDDLTRWDGVKDAPYYFDR
NAAERICRFKELMPHVKGIWARQREKLHLEPWQCFIDTTLFGWKRTADGLRRFREAYEEI
PRKNGKSCFVAPLGLYMLTEDGEEGAEVYSGATTEKQAWEVYGPARLMALRAEGFTDHYG
VDVRAKNMNILRTASKFEPLIGDPGDGASPHCAIVDEYHEHDGPRLYDTMITGMGARSQP
LMVVITTAGFNLGGPCYDMRLRVQKVLDNTLQDNELFGIIYTIDDGDDWQSEESLRKANP
NYGVSVRADYLQSQLRKAIQNPSKQNTFKTKHLNVWCNARSAWMNMATWERQADAELRIE
DFAGEPCWFALDLASKLDLNAAAYLFKRGEHFYLFADFWLPTDALESVVNADIYRGWSTA
GWITLTDGGMVDYDAIEERIKERAKLLTPIEMPYDPFQAAQLVTHLADEGIPMVEFGATV
KNFSEPMKQLEALVASGKLHHNGNPVLTWCISNVVCHTDAKDNVFPRKDRAEYKIDGAVA
AIMAMGRALAAPVDDGTITQGFVVL