Protein Info for DVU1463 in Desulfovibrio vulgaris Hildenborough JW710

Name: cysG-1
Annotation: siroheme synthase, N-terminal domain protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 225 TIGR01470: siroheme synthase, N-terminal domain" amino acids 4 to 208 (205 residues), 119.7 bits, see alignment E=6.8e-39 PF13241: NAD_binding_7" amino acids 6 to 117 (112 residues), 87.4 bits, see alignment E=8.9e-29 PF14824: Sirohm_synth_M" amino acids 122 to 146 (25 residues), 26.8 bits, see alignment (E = 2.9e-10)

Best Hits

KEGG orthology group: K02304, precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC: 1.3.1.76 4.99.1.4] (inferred from 100% identity to dvl:Dvul_1616)

Predicted SEED Role

"Siroheme synthase / Precorrin-2 oxidase (EC 1.3.1.76)" in subsystem Experimental tye or Heme and Siroheme Biosynthesis (EC 1.3.1.76)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.99.1.4

Use Curated BLAST to search for 1.3.1.76 or 4.99.1.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72C21 at UniProt or InterPro

Protein Sequence (225 amino acids)

>DVU1463 siroheme synthase, N-terminal domain protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MRPYPLFMRLDGCRCLVVGAGGVGRRKLAALIPCGAAEILVLDTSPPDAELAALLACPGV
RFEQRTFSADDLAGRSLVFAATGVPAANADIARLCRDGGVLCNVIDDPAAGSFIVPAHFA
CGDITVALSTGGHSPALARRIRMDLEAWFGNRYDGLVVLMGRLRPLVLALGDETGQNAAL
FRTIVGSPLVDALAAKDRQRCEDLLHTLLPVELHPHIVELLHDIA