Protein Info for DVU1454 in Desulfovibrio vulgaris Hildenborough JW710

Name: ispD
Annotation: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00453: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase
  • amino acids 4 to 229 (226 residues), 210.1 bits, E=2.7e-66
• PF01128: IspD
  • amino acids 5 to 227 (223 residues), 193.1 bits, E=9.1e-61
• PF12804: NTP_transf_3
  • amino acids 6 to 139 (134 residues), 34.9 bits, E=2.7e-12
• PF02542: YgbB
  • amino acids 239 to 389 (151 residues), 189.8 bits, E=6.1e-60
• TIGR00151: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
  • amino acids 239 to 389 (151 residues), 175.1 bits, E=1.1e-55

Best Hits

Swiss-Prot: 100% identical to ISPDF_DESVH: Bifunctional enzyme IspD/IspF (ispDF) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: K12506, 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase / 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase [EC: 2.7.7.60 4.6.1.12] (inferred from 100% identity to dvl:Dvul_1625)

Predicted SEED Role

"2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (EC 2.7.7.60) / 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (EC 4.6.1.12)" in subsystem Isoprenoid Biosynthesis or polyprenyl synthesis or Teichoic and lipoteichoic acids biosynthesis (EC 2.7.7.60, EC 4.6.1.12)

MetaCyc Pathways

• methylerythritol phosphate pathway II (9/9 steps found)
• superpathway of geranylgeranyl diphosphate biosynthesis II (via MEP) (10/12 steps found)
• taxadiene biosynthesis (engineered) (10/13 steps found)
• methylerythritol phosphate pathway I (7/9 steps found)
• isoprene biosynthesis I (7/10 steps found)
• superpathway of ergosterol biosynthesis II (9/26 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Terpenoid biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.60 or 4.6.1.12

Sequence Analysis Tools

See Q72C30 at UniProt or InterPro

Protein Sequence (395 amino acids)

>DVU1454 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MRTWVLLLAAGSGTRLATAGLPDAKQFLPLHGAPLYWASARTMAHVAGIEGIVFVFPPHR
VEEERARISALDDGSVLGLDWHVVGGGAARQDSVACGLAALPRSCEAVLVHDAARPFASP
ALVARVLSALHDGHAGVVPGIPLTDTVKETTDGFVANTPDRSRLVAVQTPQGFTLKALST
AHETARTAGWNVTDDAALLERCGIPVRIVAGEVVNAKITTPEDLAMLDANEPQVTVPCVG
WGYDVHRYGEGRPMKLGGVLIPEGPEVVAHSDGDVLLHALADALLGCIGAGDIGLHFPDS
DAAFDNANSAMLLDRVLHMTHEARLRLTHVDLTIVAQVPKLSPWRDKIRANVARLLDLPV
TSVNFKATTEEGLGFTGEKRGIKAIAAVTGLRPMP