Protein Info for DVU1443 in Desulfovibrio vulgaris Hildenborough JW710

Name: flgE
Annotation: flagellar hook protein FlgE (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 564 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details TIGR03506: flagellar hook-basal body protein" amino acids 6 to 545 (540 residues), 322.6 bits, see alignment E=2.4e-100 PF00460: Flg_bb_rod" amino acids 9 to 37 (29 residues), 34.4 bits, see alignment (E = 3.3e-12) PF22692: LlgE_F_G_D1" amino acids 88 to 140 (53 residues), 51.7 bits, see alignment 1.6e-17 PF07559: FlgE_D2" amino acids 218 to 444 (227 residues), 77.7 bits, see alignment E=2.6e-25 PF06429: Flg_bbr_C" amino acids 518 to 562 (45 residues), 56 bits, see alignment 4.6e-19

Best Hits

KEGG orthology group: K02390, flagellar hook protein FlgE (inferred from 100% identity to dvu:DVU1443)

Predicted SEED Role

"Flagellar hook protein FlgE" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72C41 at UniProt or InterPro

Protein Sequence (564 amino acids)

>DVU1443 flagellar hook protein FlgE (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MSLTASMWTGVSGLLAHGERMNVLGNNIANVNTVGFKGSRMDFEDFLNQDTYSAAGVTQV
GRGVSIGAIFGDYSQGAFQTTNESTDLAIQGRGFFSVKPKGTEDTYYTRAGNFRFDADGY
LVDPHGYVLQGWAIERSQNSLTSSAVTATSTTSKIKGSGVPVDIKLDGFTAEPQHTQNIT
LNVNLDSNPGNDKSSSTTNPYFSLFETWNGQNPLTGTQPALAQSAFAYQSTIKVYDEAGT
AHTLTVYFDQVDPDSVTNEPNGRKQWEYIVTMDPAEDKRVIAGTAMNTTRAAGLLMTGTL
TFDTTGQLVDQTAFTPFGQYTDTTPPWNEPTPNPGPPVTTPADLVNWQPTQMSSNGLPMM
VANFSGLTDSSVVGSPTAQNFLMELDLGLRSTNATTPWTSTPNAAAIGTDASLLPGLTSS
QRQPSATTSYAGSSSTQFQKQDGYTFGFLQNITVDRDGIMQGKYSNGVTLDLYQVTLVDF
TSKQNLRREGGNLFSGTRDSGDPLPGPANSNGLGAISSNSLEQSNVDLAREFVEMITTQR
GFQSNSKVITTTDTMLEVVVNMKR