Protein Info for DVU1435 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: membrane protein, putative (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 394 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details transmembrane" amino acids 54 to 74 (21 residues), see Phobius details amino acids 81 to 99 (19 residues), see Phobius details amino acids 105 to 128 (24 residues), see Phobius details amino acids 139 to 158 (20 residues), see Phobius details amino acids 170 to 189 (20 residues), see Phobius details amino acids 212 to 234 (23 residues), see Phobius details amino acids 252 to 271 (20 residues), see Phobius details amino acids 278 to 296 (19 residues), see Phobius details amino acids 301 to 324 (24 residues), see Phobius details amino acids 335 to 356 (22 residues), see Phobius details amino acids 363 to 385 (23 residues), see Phobius details PF07690: MFS_1" amino acids 20 to 279 (260 residues), 88.8 bits, see alignment E=1.7e-29 amino acids 225 to 384 (160 residues), 35.8 bits, see alignment E=2.3e-13

Best Hits

KEGG orthology group: K02575, MFS transporter, NNP family, nitrate/nitrite transporter (inferred from 100% identity to dvl:Dvul_1642)

Predicted SEED Role

"Nitrate/nitrite transporter" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72C49 at UniProt or InterPro

Protein Sequence (394 amino acids)

>DVU1435 membrane protein, putative (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MSTSTETSFRKALPWTAFVALLFMLNYTARSALSPLLVDLERDLAVGHAQATGLLLVQAA
GFSASQFVCGFLLARISPGRMVALSLTLSGLCLLGMSLVETLGTARLVFGLFGFMAGLYF
PAGMATLSSLVSPRDWGKAVAVHELAPNTSFILLPLFAEAALRHMDWRGVFSVLGSCLAL
LGLAFALFGRGGRTLAAPPSYAGCREALRTPATWVFIVLFSVCVAGEFATFSVLPVHLVT
ELHFTETTANQLVSLSRLLCPFAAVAGGWFADRAGAGGIIKGYLLLHGAALSLMALSEPV
WVFIGMSAQAFVTAFSFPALFKAFAQSFPAARQPLLLSLTMPVACLIGTGAAPAFLGLCG
QHASFGAGFMALGGISVLTLLTLRALPHAALGRG