Protein Info for DVU1425 in Desulfovibrio vulgaris Hildenborough JW710

Name: gcvPA
Annotation: glycine cleavage system P protein, subunit 1 (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 443 PF02347: GDC-P" amino acids 3 to 435 (433 residues), 382.5 bits, see alignment E=1.4e-118

Best Hits

Swiss-Prot: 100% identical to GCSPA_DESVH: Probable glycine dehydrogenase (decarboxylating) subunit 1 (gcvPA) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: K00282, glycine dehydrogenase subunit 1 [EC: 1.4.4.2] (inferred from 100% identity to dvl:Dvul_1651)

Predicted SEED Role

"Glycine dehydrogenase [decarboxylating] (glycine cleavage system P1 protein) (EC 1.4.4.2)" in subsystem Glycine and Serine Utilization or Glycine cleavage system or Photorespiration (oxidative C2 cycle) (EC 1.4.4.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.4.4.2

Use Curated BLAST to search for 1.4.4.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72C59 at UniProt or InterPro

Protein Sequence (443 amino acids)

>DVU1425 glycine cleavage system P protein, subunit 1 (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MPFVPHSPEDVSVMLDAIGVNTIEDLFADIPAEMRPKSFALPKGLSEMDVCSRLEALSAR
NRTDVVSFLGAGFYDHHIPKAVDALSSRGEFYTAYTPYQPEAAQGTLQAIFEFQTAVCRL
LDMDCANASVYDGGSALFEAMMMAVRATRRRKLVIDEALSPIYRTMLASYTSNLQLELVT
VPHRDGLSDMDALKASVDDTCAAVVVQNPNFFGAITDFTDLFTHARAHKALGVISVYPVM
QSVLKTPGEMGADIAVADGQSIGQPLSFGGPYLGIMTCTKPLVRQIPGRIVGRTQDVDGR
TGYVLTLQAREQHIRRAKATSNICSNQALCALRSLIHLTLLGPEGLVRTAELSMERARYA
AERLTALPGVELLHDAPFGNEFAVRLPVSAFEVVDRLTARGYVPGFPVGRYYPGMDNVLL
VACTEKHSFEQVGILAEMLGGIL