Protein Info for DVU1397 in Desulfovibrio vulgaris Hildenborough JW710

Name: bfr
Annotation: bacterioferritin (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 179 PF00210: Ferritin" amino acids 15 to 146 (132 residues), 84.3 bits, see alignment E=1.2e-27 PF02915: Rubrerythrin" amino acids 16 to 142 (127 residues), 42.3 bits, see alignment E=1.5e-14 PF12902: Ferritin-like" amino acids 18 to 81 (64 residues), 27.7 bits, see alignment E=3.6e-10

Best Hits

Swiss-Prot: 71% identical to BFR_DESDA: Bacterioferritin (bfr) from Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949)

KEGG orthology group: K03594, bacterioferritin (inferred from 100% identity to dvu:DVU1397)

Predicted SEED Role

"Bacterioferritin" in subsystem Iron acquisition in Vibrio

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72C87 at UniProt or InterPro

Protein Sequence (179 amino acids)

>DVU1397 bacterioferritin (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MTTATDREQRKAKVIEVLNKARAMELYAITQYMNQHYGLDSMDYGELAANVKLIAIDEMR
HAEMFAERIKELGGEPTTDPEGAIIKGQEVRIVFPFDADLEDDTIDAYNQFLLVCRECGD
SVSMKLFETIIDEEQAHFNYFDNVGGHIRTLGDTYLSKIAGTSASTGPSTKGFLLNKGG