Protein Info for DVU1364 in Desulfovibrio vulgaris Hildenborough JW710

Name: rfbB
Annotation: dTDP-glucose 4,6-dehydratase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 340 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF04321: RmlD_sub_bind" amino acids 1 to 273 (273 residues), 72.7 bits, see alignment E=8.7e-24 TIGR01181: dTDP-glucose 4,6-dehydratase" amino acids 2 to 321 (320 residues), 454.3 bits, see alignment E=1e-140 PF02719: Polysacc_synt_2" amino acids 3 to 266 (264 residues), 67.3 bits, see alignment E=4.1e-22 PF01073: 3Beta_HSD" amino acids 4 to 233 (230 residues), 67.4 bits, see alignment E=3.2e-22 PF01370: Epimerase" amino acids 4 to 245 (242 residues), 223 bits, see alignment E=1.2e-69 PF16363: GDP_Man_Dehyd" amino acids 4 to 307 (304 residues), 266.7 bits, see alignment E=1.1e-82 PF07993: NAD_binding_4" amino acids 76 to 182 (107 residues), 31.9 bits, see alignment E=2.4e-11

Best Hits

Swiss-Prot: 52% identical to RMLB_ACTS5: dTDP-glucose 4,6-dehydratase (acbB) from Actinoplanes sp. (strain ATCC 31044 / CBS 674.73 / SE50/110)

KEGG orthology group: K01710, dTDP-glucose 4,6-dehydratase [EC: 4.2.1.46] (inferred from 100% identity to dvu:DVU1364)

MetaCyc: 53% identical to dTDP-glucose 4,6-dehydratase monomer (Streptomyces sp. KCTC 0041BP)
dTDP-glucose 4,6-dehydratase. [EC: 4.2.1.46]

Predicted SEED Role

"dTDP-glucose 4,6-dehydratase (EC 4.2.1.46)" in subsystem Rhamnose containing glycans or dTDP-rhamnose synthesis or linker unit-arabinogalactan synthesis (EC 4.2.1.46)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.46

Use Curated BLAST to search for 4.2.1.46

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72CB9 at UniProt or InterPro

Protein Sequence (340 amino acids)

>DVU1364 dTDP-glucose 4,6-dehydratase (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MRLLVTGGCGFIGTNFIRHVLAVRPEVSVVNFDKLTYAGNPANLTDIEGEHGGNRYSFEH
GDIADAGRVRDILERHAIDAIVNFAAETHVDRSINDSTPFITTNVLGTQVLLQAALDRGI
PRFVHISTDEVYGTLGPEGLFREDTPLAPNSPYSASKAGADLMVRAFHETYGLDTVTTRC
SNNYGPYQFPEKLIPLMYRKATAGEPLPVYGDGGNVRDWIHVEDHCRGVLLALEKGRPGG
VYNFGGASERTNLDVVRLILKLTGRSEELIRFVKDRPGHDRRYAMDFTLAARELGYAPEH
SFENGLAATVDWYRANDAWLASVESGAYREFMDRWYGDRR