Protein Info for DVU1360 in Desulfovibrio vulgaris Hildenborough JW710

Name: galE
Annotation: UDP-glucose 4-epimerase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF05368: NmrA
  • amino acids 8 to 164 (157 residues), 31.7 bits, E=5.8e-11
• TIGR01179: UDP-glucose 4-epimerase GalE
  • amino acids 9 to 328 (320 residues), 439.4 bits, E=3.2e-136
• PF04321: RmlD_sub_bind
  • amino acids 9 to 163 (155 residues), 52.8 bits, E=1.5e-17
• PF02719: Polysacc_synt_2
  • amino acids 10 to 179 (170 residues), 37.7 bits, E=6.2e-13
• PF01370: Epimerase
  • amino acids 10 to 258 (249 residues), 206.6 bits, E=1.8e-64
• PF01073: 3Beta_HSD
  • amino acids 11 to 168 (158 residues), 63.5 bits, E=7.7e-21
• PF16363: GDP_Man_Dehyd
  • amino acids 11 to 313 (303 residues), 202.4 bits, E=6.2e-63
• PF13460: NAD_binding_10
  • amino acids 14 to 160 (147 residues), 44.9 bits, E=5.6e-15

Best Hits

Swiss-Prot: 51% identical to GALE_BACHD: UDP-glucose 4-epimerase (galE) from Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)

KEGG orthology group: K01784, UDP-glucose 4-epimerase [EC: 5.1.3.2] (inferred from 100% identity to dvl:Dvul_1708)

MetaCyc: 51% identical to UDP-xylose 4-epimerase subunit (Sinorhizobium meliloti 1021)
UDP-arabinose 4-epimerase. [EC: 5.1.3.5]

Predicted SEED Role

"UDP-glucose 4-epimerase (EC 5.1.3.2)" in subsystem Lacto-N-Biose I and Galacto-N-Biose Metabolic Pathway or Lactose and Galactose Uptake and Utilization or N-linked Glycosylation in Bacteria or Rhamnose containing glycans or linker unit-arabinogalactan synthesis (EC 5.1.3.2)

MetaCyc Pathways

• colanic acid building blocks biosynthesis (10/11 steps found)
• UDP-α-D-galactose biosynthesis (1/1 steps found)
• UDP-β-L-arabinose biosynthesis I (from UDP-α-D-xylose) (1/1 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis I (1/1 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (4/6 steps found)
• UDP-α-D-galactofuranose biosynthesis (1/2 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis II (4/7 steps found)
• D-galactose detoxification (1/3 steps found)
• D-galactose degradation I (Leloir pathway) (2/5 steps found)
• UDP-sugars interconversion (4/9 steps found)
• stachyose degradation (2/7 steps found)
• teichuronic acid biosynthesis (B. subtilis 168) (2/9 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (13/33 steps found)
• mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (1/18 steps found)

KEGG Metabolic Maps

• Galactose metabolism
• Nucleotide sugars metabolism

Isozymes

Compare fitness of predicted isozymes for: 5.1.3.2

Use Curated BLAST to search for 5.1.3.2 or 5.1.3.5

Sequence Analysis Tools

See Q72CC3 at UniProt or InterPro

Protein Sequence (331 amino acids)

>DVU1360 UDP-glucose 4-epimerase (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MTVSGCCSNVLVCGGAGYIGSHMVRALVEHGYVPIIFDNLSTGHAESVGDVDLVRGDLLD
RQALRRLFAEHSFDAVMHFSAKSLVGESMTDPGIYFVNNVVGTINLLEAMREAGVSRLVF
SSSAAVFGNPLTARIAEDHPRQPVNPYGRSKLMIEQALRDYANAYGMRSVSLRYFNAAGA
DEAGDIGESHKPETHLIPNVLRAALGTGPELKIFGDDYDTPDGTCVRDYIHVADLCDAHL
RALSYMQLKPGAHAFNLGNGNGFSVKQVVEAAWRVTGRDVPHSMAPRRPGDPAWLVADST
LAERELGWKPSFTDIDAIIDSAWRWHQKPRY