Protein Info for DVU1358 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: hydrolase, haloacid dehalogenase-like family (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00702: Hydrolase
  • amino acids 15 to 190 (176 residues), 63.8 bits, E=4.6e-21
• PF13419: HAD_2
  • amino acids 16 to 196 (181 residues), 59.7 bits, E=6.4e-20
• PF13242: Hydrolase_like
  • amino acids 153 to 220 (68 residues), 51.8 bits, E=9.7e-18

Best Hits

KEGG orthology group: K01091, phosphoglycolate phosphatase [EC: 3.1.3.18] (inferred from 100% identity to dvl:Dvul_1710)

Predicted SEED Role

"hydrolase, haloacid dehalogenase-like family"

MetaCyc Pathways

• photorespiration I (6/9 steps found)
• photorespiration III (6/9 steps found)
• photorespiration II (6/10 steps found)

KEGG Metabolic Maps

• Glyoxylate and dicarboxylate metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.18

Use Curated BLAST to search for 3.1.3.18

Sequence Analysis Tools

See Q72CC5 at UniProt or InterPro

Protein Sequence (230 amino acids)

>DVU1358 hydrolase, haloacid dehalogenase-like family (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MTKPPLLPGGARLGAVVFDFDGTLARPELDFGVMRRAVSEAVVPFMPQAEPRPDLPVMEW
LQTVHDALAATAPQKADRAFAAGHDAIRAVEVEAARRTSLFPFVRPLLAALTTAGVATGI
ITRNCPEAVRTVFPDVDEHCGCLLTRDDVKVVKPHPGHLLEALALLQRGPHETLMVGDHR
MDVETGIRAGAFTAGVASGETSRELLHEAGATYVADDCHDLFTRLGLFTA