Protein Info for DVU1351 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: membrane protein, MarC family (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 45 to 65 (21 residues), see Phobius details amino acids 72 to 92 (21 residues), see Phobius details amino acids 105 to 127 (23 residues), see Phobius details amino acids 138 to 157 (20 residues), see Phobius details amino acids 177 to 197 (21 residues), see Phobius details PF01914: MarC" amino acids 4 to 194 (191 residues), 158.8 bits, see alignment E=6.5e-51 TIGR00427: membrane protein, MarC family" amino acids 7 to 193 (187 residues), 104.7 bits, see alignment E=2.7e-34

Best Hits

KEGG orthology group: K05595, multiple antibiotic resistance protein (inferred from 100% identity to dvl:Dvul_1717)

Predicted SEED Role

"multiple antibiotic resistance (MarC)-related proteins"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72CD2 at UniProt or InterPro

Protein Sequence (200 amino acids)

>DVU1351 membrane protein, MarC family (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MQDAFEVALPLFLIMDPVGNAAASLAILREHTPSRQRAIIRRELVFALAIVLLFHFLGDA
LLGLLDIEQSTLRLSGGIILFIIAMKMVFPPAQENDPEAVTRDPFIVPIAVPLIAGPSLL
AAVMVYARQAQAGMMGQASVLGGVLMAWGATALIMAFTPDLARILGPRAMRAMERLMGLI
LILMAVQMLENGIRIFVQSL