Protein Info for DVU1334 in Desulfovibrio vulgaris Hildenborough JW710

Name: tig
Annotation: trigger factor (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 433 PF05697: Trigger_N" amino acids 1 to 143 (143 residues), 134.3 bits, see alignment E=5.9e-43 TIGR00115: trigger factor" amino acids 12 to 418 (407 residues), 375.2 bits, see alignment E=1.9e-116 PF05698: Trigger_C" amino acids 263 to 418 (156 residues), 77.3 bits, see alignment E=2.1e-25

Best Hits

Swiss-Prot: 100% identical to TIG_DESVH: Trigger factor (tig) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: K03545, trigger factor (inferred from 100% identity to dvl:Dvul_1735)

Predicted SEED Role

"Cell division trigger factor (EC 5.2.1.8)" in subsystem Bacterial Cell Division (EC 5.2.1.8)

Isozymes

Compare fitness of predicted isozymes for: 5.2.1.8

Use Curated BLAST to search for 5.2.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72CE9 at UniProt or InterPro

Protein Sequence (433 amino acids)

>DVU1334 trigger factor (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MEYKVEDVSPVKKKVNVTVPVEEVDAALGAAIAMYRTSVNLDGFRKGKVPASIVENRFRK
EIYAEATQDLVNVHINEIVTSLAVSPLSRIDFDGGELERGKEFSYTISFEVMPQFDLPDY
EGFAVEQEKAVVDEKEVDEVIARIRRNMAELVPVAETRPGADGDVVVLDFAAFENGEPIE
GVSAENFQLSLGEKQSLEDFENLVKTIPAGQEAEGPITFPDDFLNPDFAGKTVTMKVKVH
AVKERRLPEIDDALAQKAGGFESMEKMRETVVTSYMQSREQLHKATAQKSMLDKLLKMVD
FALPESMVDMYVGNLIEDMRVKMERQGRGLESLGKTPEQLREQVLPEAQQIARSQIFLLA
AGRKEAVEVSEQEVDGQLQQLAMRSGQDFDTLKDYYVRNGLIFNLRDRLIADKAMDAIYA
KANVTMVDPAPAA